DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zip and Myh10

Sequence 1:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster
Sequence 2:XP_008766103.1 Gene:Myh10 RGDID:71000 Length:2007 Species:Rattus norvegicus

Alignment Length:2007 Identity:1231/2008 (61%)
Similarity:1560/2008 (78%) Gaps:65/2008 (3%)


  Fly    46 MSEEVDRNDPELKYLSVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVEVELAE 110
            |::.....||| :||.|:|....:|||||:||.|:|||:|.|..||.|||||.|.||||.|||||
  Rat     1 MAQRTGLEDPE-RYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAE 64

  Fly   111 TGKRVMILRDDIQKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYK 175
            .||:.|:.:|||||||||||.|||||||||||||||||||:|||||||||||||||||||:||||
  Rat    65 NGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYK 129

  Fly   176 KLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQF 240
            .||||:|.|:|.|:|.||||:|||::||::||||.||.||||||||||||||||||||||||||:
  Rat   130 NLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQY 194

  Fly   241 LAYVAASKPKGSGAVPHPAVLINFSVNTNKYIKVKIMAQNQNQTIEVVNGLKMVEVNSNCQEGEL 305
            ||:||:|.   .|...|     |....:.|.:|                           .:|||
  Rat   195 LAHVASSH---KGRKDH-----NIPQESPKPVK---------------------------PQGEL 224

  Fly   306 EQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDER 370
            |:||||||||||:||||||||||||||||||||||||.:|:|.||||||||||||||:|||||||
  Rat   225 ERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDER 289

  Fly   371 TFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFN 435
            |||||||||:||....:...:|:...:|.|||||.:|:||..|...||.|:::|:|||.:.|:..
  Rat   290 TFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEIL 354

  Fly   436 SIFRIVSAVLLFGSMKFRQERNNDQATLPDNTVAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVT 500
            |:.::||:||.||::.|::|||.|||::|:||||||:.||||::|.:.|||.||||||||||:|.
  Rat   355 SMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQ 419

  Fly   501 KAQTKEQVEFAVEAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQL 565
            |||||||.:|||||:|||.|||:|:|||:|||::||||||||||||||||:||||||||||||||
  Rat   420 KAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQL 484

  Fly   566 CINYTNEKLQQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPG---GIMALLDEEC 627
            ||||||||||||||||||||||||||||||||.||||||||||.||||::|.   |::|||||||
  Rat   485 CINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEEC 549

  Fly   628 WFPKATDKTFVDKLVSAHSMHPKFMK-TDFRGVADFAIVHYAGRVDYSAAKWLMKNMDPLNENIV 691
            |||||||||||:|||.....|.||.| ...:..|||.|:||||:|||.|.:||||||||||:|:.
  Rat   550 WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVA 614

  Fly   692 SLLQGSQDPFVVNIWKDA----------------------EIVGMAQ-QALTDTQFGA--RTRKG 731
            :||..|.|.||..:|||.                      .|||:.| ..:|:|.||:  :|:||
  Rat   615 TLLHQSSDRFVAELWKDEIQNIQRASFYDSVSGLHEPPVDRIVGLDQVTGMTETAFGSAYKTKKG 679

  Fly   732 MFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRCNGVLEGIRICRQ 796
            |||||..||||.|.|||.|||||||||||||||||||||||:|..||||||||||||||||||||
  Rat   680 MFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQ 744

  Fly   797 GFPNRIPFQEFRQRYELLTPNVIPKGFMDGKKACEKMIQALELDSNLYRVGQSKIFFRAGVLAHL 861
            ||||||.|||||||||:||||.|||||||||:|||:||:|||||.||||:|||||||||||||||
  Rat   745 GFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHL 809

  Fly   862 EEERDFKISDLIVNFQAFCRGFLARRNYQKRLQQLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKP 926
            |||||.||:|:|:.|||.|||:|||:.:.|:.|||:|::::|||||||||||:|||||::|||||
  Rat   810 EEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKP 874

  Fly   927 LLEVTKQEEKLVQKEDELKQVREKLDTLAKNTQEYERKYQQALVEKTTLAEQLQAEIELCAEAEE 991
            ||:||:|||:|..|::||.:|:||...:....:|.|||:||.|.||..||||||||.||.|||||
  Rat   875 LLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEE 939

  Fly   992 SRSRLMARKQELEDMMQELETRIEEEEERVLALGGEKKKLELNIQDLEEQLEEEEAARQKLQLEK 1056
            .|:||.|:|||||:::.:||:|:||||||...|..||||::.:||||||||:|||.|||||||||
  Rat   940 MRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEK 1004

  Fly  1057 VQLDAKIKKYEEDLALTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHLAKLKAKHEATISE 1121
            |..:|||||.||::.|.:|||.|.:|||||:|:|..:.|..|||||||||:|||::.|.|..||:
  Rat  1005 VTAEAKIKKMEEEVLLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISD 1069

  Fly  1122 LEERLHKDQQQRQESDRSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEES 1186
            |||||.|:::.|||.:::|||::.|..||::|:.|.:.||||::.||.|:||||...|.|.|:|:
  Rat  1070 LEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQVDELKVQLTKKEEELQGALARGDDET 1134

  Fly  1187 ATKATAQKAQRELESQLAEIQEDLEAEKAARAKAEKVRRDLSEELEALKNELLDSLDTTAAQQEL 1251
            ..|..|.|..|||::|:||:|||.|:|||:|.||||.:|||||||||||.||.|:||||||||||
  Rat  1135 LHKNNALKVARELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQEL 1199

  Fly  1252 RSKREQELATLKKSLEEETVNHEGVLADMRHKHSQELNSINDQLENLRKAKTVLEKAKGTLEAEN 1316
            |:|||||:|.|||:||:||.|||..:.|||.:|:..|..:::|||..::.|..|||.|..||.:|
  Rat  1200 RTKREQEVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDN 1264

  Fly  1317 ADLATELRSVNSSRQENDRRRKQAESQIAELQVKLAEIERARSELQEKCTKLQQEAENITNQLEE 1381
            .:||.|::.:...:.|::.:||:.::|:.||..|::|.:|.|.||.||..|||.|.:|::..|||
  Rat  1265 KELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEE 1329

  Fly  1382 AELKASAAVKSASNMESQLTEAQQLLEEETRQKLGLSSKLRQIESEKEALQEQLEEDDEAKRNYE 1446
            ||.|.....|.|:.:||||.:.|:||:|||||||.|||::||:|.||.:||||.||::||::|.|
  Rat  1330 AEKKGMKFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLE 1394

  Fly  1447 RKLAEVTTQMQEIKKKAEEDADLAKELEEGKKRLNKDIEALERQVKELIAQNDRLDKSKKKIQSE 1511
            :::..:.:|:.:.|||.::|....:.|||.||:|.||:|||.::::|.:...|:|:|:|.::|.|
  Rat  1395 KQVLALQSQLADTKKKVDDDLGTIEGLEEAKKKLLKDVEALSQRLEEKVLAYDKLEKTKNRLQQE 1459

  Fly  1512 LEDATIELEAQRTKVLELEKKQKNFDKILAEEKAISEQIAQERDTAEREAREKETKVLSVSRELD 1576
            |:|.|::|:.||..|..||||||.||::|||||.||.:.|:|||.||.||||||||.||::|.|:
  Rat  1460 LDDLTVDLDHQRQIVSNLEKKQKKFDQLLAEEKGISARYAEERDRAEAEAREKETKALSLARALE 1524

  Fly  1577 EAFDKIEDLENKRKTLQNELDDLANTQGTADKNVHELEKAKRALESQLAELKAQNEELEDDLQLT 1641
            ||.:..|:.|.:.|.|:.:::||.:::....||||||||:|||||.|:.|::.|.|||||:||.|
  Rat  1525 EALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQAT 1589

  Fly  1642 EDAKLRLEVNMQALRSQFERDLLAKEEGAEEKRRGLVKQLRDLETELDEERKQRTAAVASKKKLE 1706
            |||||||||||||:::||||||..::|..|||:|.|:||:|:||.||::|||||..|||||||:|
  Rat  1590 EDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLLKQVRELEAELEDERKQRALAVASKKKME 1654

  Fly  1707 GDLKEIETTMEMHNKVKEDALKHAKKLQAQVKDALRDAEEAKAAKEELQALSKEAERKVKALEAE 1771
            .|||::|..:|..||.:::.:|..:|||||:||..|:.|||:|:::|:.|.|||:|:|:|:||||
  Rat  1655 IDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAE 1719

  Fly  1772 VLQLTEDLASSERARRAAETERDELAEEIANNANKGSLMIDEKRRLEARIATLEEELEEEQSNSE 1836
            :|||.|:|||||||||.||.||||||:||||:|:..|.::|||||||||||.|||||||||||.|
  Rat  1720 ILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNME 1784

  Fly  1837 VLLDRSRKAQLQIEQLTTELANEKSNSQKNENGRALLERQNKELKAKLAEIETAQRTKVKATIAT 1901
            :|.||.||..||::.|.||||.|:|.:||::|.|..||||||||||||.|:|.|.::|.||||:.
  Rat  1785 LLNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISA 1849

  Fly  1902 LEAKIANLEEQLENEGKERLLQQKANRKMDKKIKELTMNIEDERRHVDQHKEQMDKLNSRIKLLK 1966
            |||||..||||||.|.|||....|..|:.:||:||:.|.:||||||.||:||||:|.|:|:|.||
  Rat  1850 LEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLK 1914

  Fly  1967 RNLDETEEELQKEKTQKRKYQRECEDMIESQEAMNREINSLKTKLRRTGGIGLSSSR 2023
            |.|:|.|||..:....:||.|||.:|..|:.|.::||:::||.:|||.|.|..||||
  Rat  1915 RQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSR 1971

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zipNP_523860.2 Myosin_N 80..117 CDD:280832 25/37 (68%)
Myosin_head 133..854 CDD:278492 509/750 (68%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 497/738 (67%)
Myosin_tail_1 931..2011 CDD:279860 605/1080 (56%)
Prefoldin 1431..1515 CDD:298833 35/84 (42%)
FAM76 <1847..1926 CDD:292665 49/79 (62%)
Myh10XP_008766103.1 Myosin_N 34..72 CDD:280832 25/38 (66%)
Myosin_head 87..802 CDD:278492 509/750 (68%)
MYSc_Myh10 99..802 CDD:276952 497/738 (67%)
Myosin_tail_1 879..1959 CDD:279860 605/1080 (56%)
DUF2317 <1142..1253 CDD:302887 69/111 (62%)
ApoLp-III_like 1224..1371 CDD:304399 64/147 (44%)
GBP_C <1535..1641 CDD:303769 62/106 (58%)
coiled coil 1631..1641 CDD:293879 6/10 (60%)
DUF106 <1676..>1727 CDD:303007 29/51 (57%)
DUF2570 1800..>1898 CDD:305162 60/98 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0161
Hieranoid 1 1.000
Homologene 1 1.000 H55941
Inparanoid 1 1.050 2307 1.000 Inparanoid score I29
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000023
OrthoInspector 1 1.000 T618413
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45615
Phylome 1 0.910 0.889 Consistency score
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.