DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zip and MYH9

Sequence 1:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster
Sequence 2:NP_002464.1 Gene:MYH9 HGNCID:7579 Length:1960 Species:Homo sapiens

Alignment Length:2003 Identity:1199/2004 (60%)
Similarity:1541/2004 (77%) Gaps:68/2004 (3%)


  Fly    58 KYLSVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVEVELAETGKRVMILRDDI 122
            |||.|::|..|:|..||:|..|:|||||.:..||..||:|.|.|:|..|||.|.||:|.:.:|||
Human     8 KYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDI 72

  Fly   123 QKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMER 187
            ||||||||.|||||||||||||||||||:|:|||||||||||||||||:||||.||||:|:|:|.
Human    73 QKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEM 137

  Fly   188 YKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAASKPKGS 252
            |||.||||:|||::||||:|||:|:.||||||||||||||||||||||||||:|||||:|.    
Human   138 YKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSH---- 198

  Fly   253 GAVPHPAVLINFSVNTNKYIKVKIMAQNQNQTIEVVNGLKMVEVNSNCQEGELEQQLLQANPILE 317
                                                        .|...:||||:||||||||||
Human   199 --------------------------------------------KSKKDQGELERQLLQANPILE 219

  Fly   318 AFGNAKTVKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGA 382
            |||||||||||||||||||||||||.:|:|.|||||||||||||||||||:||||||||.||:||
Human   220 AFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGA 284

  Fly   383 TPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSAVLLF 447
            ....:...:|:....|.|||||.:.:||..|...||.|:::|.|||:..|:...:.|::|.||..
Human   285 GEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQL 349

  Fly   448 GSMKFRQERNNDQATLPDNTVAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVTKAQTKEQVEFAV 512
            |::.|::|||.|||::||||.|||::||||::|||.||..||||||||||:|.|||||||.:||:
Human   350 GNIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAI 414

  Fly   513 EAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQL 577
            ||:|||.|||||:|||.|||::||:|||||||||||||:||||||:|||||||||||||||||||
Human   415 EALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQL 479

  Fly   578 FNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPG---GIMALLDEECWFPKATDKTFVD 639
            ||||||||||||||||||||.||||||||||.||||:||.   ||:|||||||||||||||:||:
Human   480 FNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVE 544

  Fly   640 KLVSAHSMHPKFMK-TDFRGVADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVV 703
            |::.....||||.| ...:..|||.|:||||:|||.|.:||||||||||:||.:||..|.|.||.
Human   545 KVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVS 609

  Fly   704 NIWKDAE-IVGMAQQA-LTDTQF-GA-RTRKGMFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIP 764
            .:|||.: |:|:.|.| :::|.. || :|||||||||..||||||||||.|||||||||||||||
Human   610 ELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIP 674

  Fly   765 NHEKRAGKIDAPLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYELLTPNVIPKGFMDGKKA 829
            ||||:|||:|..|||||||||||||||||||||||||:.|||||||||:||||.|||||||||:|
Human   675 NHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQA 739

  Fly   830 CEKMIQALELDSNLYRVGQSKIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGFLARRNYQKRLQ 894
            |..||:||||||||||:||||:|||||||||||||||.||:|:|:.|||.|||:|||:.:.||.|
Human   740 CVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQ 804

  Fly   895 QLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLLEVTKQEEKLVQKEDELKQVREKLDTLAKNTQ 959
            ||.|::::||||||||||||||||||:|||||||:|::|||:::.||:||.:||||.........
Human   805 QLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLT 869

  Fly   960 EYERKYQQALVEKTTLAEQLQAEIELCAEAEESRSRLMARKQELEDMMQELETRIEEEEERVLAL 1024
            |.|....|.:.||..|.||||||.||||||||.|:||.|:|||||::..:||.|:||||||...|
Human   870 EMETLQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHL 934

  Fly  1025 GGEKKKLELNIQDLEEQLEEEEAARQKLQLEKVQLDAKIKKYEEDLALTDDQNQKLLKEKKLLEE 1089
            ..||||::.|||:|||||||||:||||||||||..:||:||.||:..:.:|||.||.|||||||:
Human   935 QAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLED 999

  Fly  1090 RANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERLHKDQQQRQESDRSKRKIETEVADLKEQL 1154
            |..:.:..|.|||||:|.|||||.||||.|::|||||.::::||||.::::||:|.:..||.:|:
Human  1000 RIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQI 1064

  Fly  1155 NERRVQVDEMQAQLAKREEELTQTLLRIDEESATKATAQKAQRELESQLAEIQEDLEAEKAARAK 1219
            .|.:.|:.|::.||||:||||...|.|::||:|.|..|.|..||||||::|:|||||:|:|:|.|
Human  1065 AELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNK 1129

  Fly  1220 AEKVRRDLSEELEALKNELLDSLDTTAAQQELRSKREQELATLKKSLEEETVNHEGVLADMRHKH 1284
            |||.:|||.|||||||.||.|:||:||||||||||||||:..|||:||||...||..:.:||.||
Human  1130 AEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKH 1194

  Fly  1285 SQELNSINDQLENLRKAKTVLEKAKGTLEAENADLATELRSVNSSRQENDRRRKQAESQIAELQV 1349
            ||.:..:.:|||..::.|..|||||.|||.|..:||.|::.:...:.:::.:||:.|:|:.||||
Human  1195 SQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQV 1259

  Fly  1350 KLAEIERARSELQEKCTKLQQEAENITNQLEEAELKASAAVKSASNMESQLTEAQQLLEEETRQK 1414
            |..|.||.|:||.:|.||||.|.:|:|..|.:::.|:|...|..|.:||||.:.|:||:||.|||
Human  1260 KFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQK 1324

  Fly  1415 LGLSSKLRQIESEKEALQEQLEEDDEAKRNYERKLAEVTTQMQEIKKKAEEDADLAKELEEGKKR 1479
            |.||:||:|:|.||.:.:|||||::|||.|.|:::|.:..|:.::|||.|:.....:..||.|::
Human  1325 LSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRK 1389

  Fly  1480 LNKDIEALERQVKELIAQNDRLDKSKKKIQSELEDATIELEAQRTKVLELEKKQKNFDKILAEEK 1544
            |.||:|.|.::.:|.:|..|:|:|:|.::|.||:|..::|:.||.....||||||.||::|||||
Human  1390 LQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEK 1454

  Fly  1545 AISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKIEDLENKRKTLQNELDDLANTQGTADKN 1609
            .||.:.|:|||.||.||||||||.||::|.|:||.::..:||...|..:.|::||.:::....|:
Human  1455 TISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKS 1519

  Fly  1610 VHELEKAKRALESQLAELKAQNEELEDDLQLTEDAKLRLEVNMQALRSQFERDLLAKEEGAEEKR 1674
            ||||||:|||||.|:.|:|.|.|||||:||.|||||||||||:||:::||||||..::|.:|||:
Human  1520 VHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKK 1584

  Fly  1675 RGLVKQLRDLETELDEERKQRTAAVASKKKLEGDLKEIETTMEMHNKVKEDALKHAKKLQAQVKD 1739
            :.||:|:|::|.||::|||||:.|||::||||.|||::|..::..||.:::|:|..:|||||:||
Human  1585 KQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKD 1649

  Fly  1740 ALRDAEEAKAAKEELQALSKEAERKVKALEAEVLQLTEDLASSERARRAAETERDELAEEIANNA 1804
            .:|:.::.:|::||:.|.:||.|:|:|::|||::||.|:||::|||:|.|:.||||||:||||::
Human  1650 CMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSS 1714

  Fly  1805 NKGSLMIDEKRRLEARIATLEEELEEEQSNSEVLLDRSRKAQLQIEQLTTELANEKSNSQKNENG 1869
            .||:|.::||||||||||.|||||||||.|:|::.||.:||.|||:|:.|:|..|:|::|||||.
Human  1715 GKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENA 1779

  Fly  1870 RALLERQNKELKAKLAEIETAQRTKVKATIATLEAKIANLEEQLENEGKERLLQQKANRKMDKKI 1934
            |..|||||||||.||.|:|...::|.||:|..||||||.|||||:||.|||....|..|:.:||:
Human  1780 RQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKL 1844

  Fly  1935 KELTMNIEDERRHVDQHKEQMDKLNSRIKLLKRNLDETEEELQKEKTQKRKYQRECEDMIESQEA 1999
            |::.:.::||||:.:|:|:|.||.::|:|.|||.|:|.|||.|:....:||.|||.||..|:.:|
Human  1845 KDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADA 1909

  Fly  2000 MNREINSLKTKLRRTGGIGLSSSRLTGTPSSKRAGGGGGGDDSSVQDESLDGE 2052
            ||||::|||.|||| |.:.....|        |....|.||.|   ||.:||:
Human  1910 MNREVSSLKNKLRR-GDLPFVVPR--------RMARKGAGDGS---DEEVDGK 1950

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zipNP_523860.2 Myosin_N 80..117 CDD:280832 20/37 (54%)
Myosin_head 133..854 CDD:278492 502/729 (69%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 490/717 (68%)
Myosin_tail_1 931..2011 CDD:279860 582/1080 (54%)
Prefoldin 1431..1515 CDD:298833 34/84 (40%)
FAM76 <1847..1926 CDD:292665 48/79 (61%)
MYH9NP_002464.1 Mediates interaction with LIMCH1. {ECO:0000269|PubMed:28228547} 2..838 601/878 (68%)
Myosin_N 29..68 CDD:308391 21/39 (54%)
Motor_domain 95..764 CDD:328930 490/717 (68%)
Actin-binding 654..676 21/22 (95%)
Myosin_tail_1 841..1921 CDD:307627 582/1080 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0161
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 2374 1.000 Inparanoid score I35
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000023
OrthoInspector 1 1.000 T609485
orthoMCL 1 0.900 OOG5_126577
Panther 1 1.100 O PTHR45615
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R786
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.