DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zip and myh3

Sequence 1:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster
Sequence 2:NP_001006915.1 Gene:myh3 XenbaseID:XB-GENE-989276 Length:1935 Species:Xenopus tropicalis

Alignment Length:1950 Identity:748/1950 (38%)
Similarity:1186/1950 (61%) Gaps:81/1950 (4%)


  Fly    82 VWVPHENQGFVAASIKREHGDEVEVELAETGKRVMILRDDIQKMNPPKFDKVEDMAELTCLNEAS 146
            ::|....:.:|..:::.:.|.:..|: .|.|:.|.:..|.|..||||||||:||||.:|.|||.|
 Frog    38 MFVVDTKESYVKGTLQSKEGGKATVK-TEAGQTVTVK
DDQIFPMNPPKFDKIEDMAMMTHLNEPS 101

  Fly   147 VLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNM 211
            ||:|:|:||.:.:||||||||||.|||||.||:|..:::..|:|.||.|.|||:|:|:|:||:.|
 Frog   102 VLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVNAYRGKKRQEAPPHIFSISDNAYQFM 166

  Fly   212 LGDREDQSILCTGESGAGKTENTKKVIQFLAYVAASKPKGSGAVPHPAVLINFSVNTNKYIKVKI 276
            |.|||:||||.|||||||||.|||:|||:.|.:||:..|                          
 Frog   167 LTDRENQSILITGESGAGKTVNTKRVIQYFATIAAAPDK-------------------------- 205

  Fly   277 MAQNQNQTIEVVNGLKMVEVNSNCQEGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINF 341
                           |..||...  :|.||.|::||||:||||||||||:|||||||||||||:|
 Frog   206 ---------------KKEEVAKT--KGTLEDQIIQANPLLEAFGNAKTVRNDNSSRFGKFIRIHF 253

  Fly   342 DASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGATPEQREKFIL-DDVKSYAFLSNGS 405
            ..:|.::.|:||||||||||...|.|.||::|||||:::...||..|..:: .:...:.|:|.|.
 Frog   254 GTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPELIEMLLITTNPYDFPFVSQGE 318

  Fly   406 LPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSAVLLFGSMKFRQERNNDQATLPDNT-VA 469
            :.|..:||..|..||..:::|:|..:::..||:::..||:.:|:|:|:|::..:||. ||.| ||
 Frog   319 ISVASIDDTEELMATDSAIDILGFNADEKVSIYKLTGAVMHYGNMRFKQKQREEQAE-PDGTEVA 382

  Fly   470 QKIAHLLGLSVTDMTRAFLTPRIKVGRDFVTKAQTKEQVEFAVEAIAKACYERMFKWLVNRINRS 534
            .|.|:|:.|:..|:.:|...||:|||.::|||.||.:||..:|.|:.||.||:||.|:|.|||..
 Frog   383 DKAAYLMCLNSADLLKALCYPRVKVGNEYVTKGQTVQQVYNSVGALGKAVYEKMFLWMVTRINEM 447

  Fly   535 LDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWKF 599
            || ||:....|||:||:||||||:.||.||||||:|||||||.|||.||:||||||::|||||:|
 Frog   448 LD-TKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEF 511

  Fly   600 IDFGLDLQPTIDLIDKPGGIMALLDEECWFPKATDKTFVDKLVSAH------SMHPKFMKTDFRG 658
            ||||:||...|:||:||.||.::|:|||.||||||.:|.:||...|      ...||..|.  :.
 Frog   512 IDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGKSNNFQKPKPAKG--KA 574

  Fly   659 VADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQD---PFVVNIWKDAEIVGMAQQALT 720
            .|.|::|||||.|||:.:.||.||.||||:.::.|.|.|..   .::.:.:..:|..|..:    
 Frog   575 EAHFSLVHYAGTVDYNISGWLEKNKDPLNDTVIGLFQKSSMKTLAYLFSSYAASEAEGAKK---- 635

  Fly   721 DTQFGARTRKGMFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRCN 785
                |.:.:...|:|||.|::|.|.|||..||.|:|:||||||||..|..|.::..|||.|||||
 Frog   636 ----GGKKKGSSFQTVSALFRENLNKLMSNLRTTHPHFVRCIIPNETKTPGAMEHELVLHQLRCN 696

  Fly   786 GVLEGIRICRQGFPNRIPFQEFRQRYELLTPNVIPKG-FMDGKKACEKMIQALELDSNLYRVGQS 849
            ||||||||||:|||:||.:.:|:|||::|..:.||:| |:|.|||.||::.::::|...||.|.:
 Frog   697 GVLEGIRICRKGFPSRILYGDFKQRYKILNASAIPEGQFIDSKKASEKLLGSIDVDHTQYRFGHT 761

  Fly   850 KIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGFLARRNYQKRLQQLNAIRIIQRNCAAYLKLRN 914
            |:||:||:|..|||.||.:::.:|...||.|||:|.|..::|.:::..|:..||.|..:::.:::
 Frog   762 KVFFKAGLLGTLEEMRDDRLAHVITRTQAMCRGYLMRVEFKKMMERREAVFTIQYNIRSFMNVKH 826

  Fly   915 WQWWRLYTKVKPLLEVTKQEEKLVQKEDELKQVREKLDTLAKNTQEYERKYQQALVEKTTLAEQL 979
            |.|.:||.|:||||:..:.|:::...::|.::.:|.|.......:|.|.|..:.|.||..|..|:
 Frog   827 WPWMKLYFKIKPLLKSAESEKEMQNMKEEFEKTKELLAKSEAKRKELEEKMVKVLQEKNDLQLQV 891

  Fly   980 QAEIELCAEAEESRSRLMARKQELEDMMQELETRIEEEEERVLALGGEKKKLELNIQDLEEQLEE 1044
            |:|.|...:|||...:|:..|.:||..|:||..|:|:|||....|..:|:|||....:|::.:::
 Frog   892 QSESENLTDAEERCDQLIKSKIQLEAKMKELNERLEDEEESNAELTAKKRKLEDECSELKKDIDD 956

  Fly  1045 EEAARQKLQLEKVQLDAKIKKYEEDLALTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHLA 1109
            .|....|::.||...:.|:|...|::|:.|:...||.||||.|:|........|..||:|...|.
 Frog   957 LELTLAKVEKEKHATENKVKNLTEEMAVLDETIVKLTKEKKALQEAHQQTLDDLQAEEDKVNTLT 1021

  Fly  1110 KLKAKHEATISELEERLHKDQQQRQESDRSKRKIETEVADLKE---QLNERRVQVDEMQAQLAKR 1171
            |.|||.|..:.:||..|.::::.|.:.:|||||:|.::...:|   .|...|.|:||   :|.|:
 Frog  1022 KAKAKLEQQVDDLEGSLEQEKKLRMDLERSKRKLEGDLKLAQETIMDLENDRQQLDE---KLKKK 1083

  Fly  1172 EEELTQTLLRIDEESATKATAQKAQRELESQLAEIQEDLEAEKAARAKAEKVRRDLSEELEALKN 1236
            |.|::|...:|::|.|..|..||..:||::::.|::|::|||:||||||||.|.|||.|||.:..
 Frog  1084 EFEMSQYASKIEDEQALGAQLQKKIKELQARIEELEEEIEAERAARAKAEKQRSDLSRELEEISE 1148

  Fly  1237 ELLDSLDTTAAQQELRSKREQELATLKKSLEEETVNHEGVLADMRHKHSQELNSINDQLENLRKA 1301
            .|.::...|:||.|:..|||.|...:::.|||.|:.||...|.:|.|.:..:..:.:|::||::.
 Frog  1149 RLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKQADSVAELGEQIDNLQRV 1213

  Fly  1302 KTVLEKAKGTLEAENADLATELRSVNSSRQENDRRRKQAESQIAELQVKLAEIERARSELQEKCT 1366
            |..|||.|..|:.|..|||:.:.:::.::...::..:..|.|::||:.|..|.:|..::|..:..
 Frog  1214 KQKLEKEKSELKMEIDDLASNMENLSKAKANFEKICRTLEDQLSELKTKDEEHQRQINDLTAQRA 1278

  Fly  1367 KLQQEAENITNQLEEAELKASAAVKSASNMESQLTEAQQLLEEETRQKLGLSSKLRQIESEKEAL 1431
            :||.|......||||.:...|...:.......|:.|.::.||||.:.|..|:..|:....:.:.|
 Frog  1279 RLQTENGEYARQLEERDSLISQLSRGKQAFTQQIEELKRQLEEEIKAKNALAHGLQSARHDCDLL 1343

  Fly  1432 QEQLEEDDEAKRNYERKLAEVTTQMQEIKKKAEEDA-DLAKELEEGKKRLNKDIEALERQVKELI 1495
            :||.||:.|||...:|.|::...::.:.:.|.|.|| ...:|||:.||:|.:.::..|..::.:.
 Frog  1344 REQYEEEQEAKGELQRSLSKANGEVAQWRTKYETDAIQRTEELEDAKKKLAQRLQEAEEHIEAVN 1408

  Fly  1496 AQNDRLDKSKKKIQSELEDATIELEAQRTKVLELEKKQKNFDKILAEEKAISEQIAQERDTAERE 1560
            ::...|:|:|:::|:|:||..:::|...:....|:||||||||||||.|...|:...|.:.:::|
 Frog  1409 SKCASLEKTKQRLQNEVEDLMVDVERSNSACAALDKKQKNFDKILAEWKQKFEESQAELEASQKE 1473

  Fly  1561 AREKETKVLSVSRELDEAFDKIEDLENKRKTLQNELDDLANTQGTADKNVHELEKAKRALESQLA 1625
            :|...|::..:....:|:.|.:|..:.:.|.||.|:.||........|.:||:||||:.:|.:..
 Frog  1474 SRSLSTELFKMKNAYEESLDHLETTKRENKNLQQEISDLTEQVSEVSKTLHEVEKAKKIIEQEKT 1538

  Fly  1626 ELKAQNEELEDDLQLTEDAKLRLEVNMQALRSQFERDLLAKEEGAEEKRRGLVKQLRDLETELDE 1690
            |:::..||.|..|:..|...||:::.:..::|:.:|.:..|:|..::.:|..|:.:..:::.||.
 Frog  1539 EIQSALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHVRVVESMQSTLDA 1603

  Fly  1691 ERKQRTAAVASKKKLEGDLKEIETTMEMHNKVKEDALKHAKKLQAQVKDALRDAEEAKAAKEELQ 1755
            |.:.|..|:..|||:||||.|:|..:...|:...::.|..:.:|..:||.....:::..|:|:|:
 Frog  1604 EIRSRNDALRLKKKMEGDLNEMEIQLSHANRQASESQKQLRNVQGLLKDVQIHLDDSLRAQEDLK 1668

  Fly  1756 ALSKEAERKVKALEAEVLQLTEDLASSERARRAAETERDELAEEIANNANKGSLMIDEKRRLEAR 1820
            ......||:...::||:.::...|..:||:|:.||.|..:.:|.:....::.:.:|:.|:::|..
 Frog  1669 EQLAMVERRANLMQAEIEEMRAALEQTERSRKVAEQELLDASERVQLLHSQNTSLINTKKKMETD 1733

  Fly  1821 IATLEEELEE---EQSNSEVLLDRSRKAQLQIEQLTTELANEKSNSQKNENGRALLERQNKELKA 1882
            |..|:.|:||   |..|:|   ::::||......:..||..|:..|...|..:..|::..|:|:.
 Frog  1734 ITQLQTEVEEAIQEARNAE---EKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLDQTVKDLQH 1795

  Fly  1883 KLAEIETAQRTKVKATIATLEAKIANLEEQLENEGKERLLQQKANRKMDKKIKELTMNIEDERRH 1947
            :|.|.|.......|..|..|||::..||.:::.|.|......|..||.::::|||:...|:::::
 Frog  1796 RLDEAEQLAMKGGKKQIQKLEARVRELENEVDVEQKRSTEAIKGVRKYERRVKELSYQSEEDKKN 1860

  Fly  1948 VDQHKEQMDKLNSRIKLLKRNLDETEEELQKEKTQKRKYQRECEDMIESQEAMNREINSLKTKLR 2012
            :.:.::.:|||..::|..||..:|.||:.....|:.||.|.|.|:..|..:....::|.|:.|.|
 Frog  1861 ILRLQDLVDKLQMKVKAYKRQTEEIEEQSNINLTKYRKIQHELEEAEERADIAESQVNKLRAKTR 1925

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zipNP_523860.2 Myosin_N 80..117 CDD:280832 7/35 (20%)
Myosin_head 133..854 CDD:278492 360/733 (49%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 352/721 (49%)
Myosin_tail_1 931..2011 CDD:279860 340/1087 (31%)
Prefoldin 1431..1515 CDD:298833 28/85 (33%)
FAM76 <1847..1926 CDD:292665 21/79 (27%)
myh3NP_001006915.1 Myosin_N 36..73 CDD:280832 7/36 (19%)
Myosin_head 88..766 CDD:278492 360/733 (49%)
Motor_domain 100..766 CDD:277568 352/721 (49%)
Myosin_tail_1 846..1923 CDD:279860 339/1083 (31%)
RILP-like 961..1094 CDD:304877 47/136 (35%)
DUF342 <1152..1240 CDD:302792 30/88 (34%)
COG6 1372..>1525 CDD:303003 49/153 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000023
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.