DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zip and Myo31DF

Sequence 1:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster
Sequence 2:NP_001188784.1 Gene:Myo31DF FlyBaseID:FBgn0086347 Length:1011 Species:Drosophila melanogaster

Alignment Length:1096 Identity:326/1097 (30%)
Similarity:528/1097 (48%) Gaps:184/1097 (17%)


  Fly   133 VEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVP 197
            |:|...|..::....:.|::.|:.:|.||||.|..||.:|||:::.||..:.:.:|||.:..|..
  Fly     9 VQDFVLLDQVSMEKFMDNLRKRFQNGSIYTYIGEVCVSMNPYRQMNIYGPETIRKYKGRELFENA 73

  Fly   198 PHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAASKPKGSGAVPHPAVLI 262
            ||:|||.|||||.:...::|..||.:|||||||||.:|.:::::|.|                  
  Fly    74 PHLFAIADSAYRVLKQRQQDTCILISGESGAGKTEASKIIMKYIAAV------------------ 120

  Fly   263 NFSVNTNKYIKVKIMAQNQNQTIEVVNGLKMVEVNSNCQEGELEQQLLQANPILEAFGNAKTVKN 327
                 ||        ||.||:...|.|                  .|:|:|.|||.||||||.:|
  Fly   121 -----TN--------AQGQNEIERVKN------------------VLIQSNAILETFGNAKTNRN 154

  Fly   328 DNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGATPEQREKFIL 392
            ||||||||::.|.||......|..|..|||||||.::|...||.||.|||||.||...:..::.|
  Fly   155 DNSSRFGKYMDIEFDYKADPVGGIITNYLLEKSRVVQQQPGERNFHSFYQLLRGANDNELRQYEL 219

  Fly   393 D-DVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSAVLLFGSMKFRQER 456
            . :...|.:|:.||:.:  :.:.::::.|..:...:|.::::..:|:|.::|||..|:::|  :.
  Fly   220 QKETGKYHYLNQGSMDI--LTEKSDYKGTCNAFKTLGFSTDEVQTIWRTIAAVLHLGNVEF--QT 280

  Fly   457 NNDQATLPDNTVAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVTKAQTKEQVEFAVEAIAKACYE 521
            ..|:..:.:....:..|.||.::.|:::.|.....|..|.:.:.|.....|.|:..:|:|||.|:
  Fly   281 IEDELVISNKQHLKSTAKLLQVTETELSTALTKRVIAAGGNVMQKDHNATQAEYGKDALAKAIYD 345

  Fly   522 RMFKWLVNRINRSL----DRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQLFNHTM 582
            |:|.|:::||||::    .:|:.:..|.||:||:.|||||:.|||||.||||.||||||||...:
  Fly   346 RLFTWIISRINRAILFRGSKTQARFNSVIGVLDIYGFEIFDSNSFEQFCINYCNEKLQQLFIELV 410

  Fly   583 FILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKP-GGIMALLDEECW-FPKATDKTFVDKLVSAH 645
            ...||||||||||||..|:: .:.:...||:::| .||:|::||.|. ..|.||.|.:..:....
  Fly   411 LKQEQEEYQREGIEWTNIEY-FNNKIICDLVEQPHKGIIAIMDEACLSVGKVTDDTLLGAMDKNL 474

  Fly   646 SMHPKFMKTDFRGV-------ADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVV 703
            |.||.:.....:..       .||.|.||||.|.|:...::.||.|.|.::...||..|:|..:.
  Fly   475 SKHPHYTSRQLKPTDKELKHREDFRITHYAGDVIYNINGFIEKNKDTLYQDFKRLLHNSKDANLS 539

  Fly   704 NIWKDAEIVGMAQQALTDTQFGARTRKGMFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIPNHEK 768
            .:|.:      ..|.:..|     |::.:  |...|::..:|.|:.||....|.:||||.||..|
  Fly   540 EMWPE------GAQDIKKT-----TKRPL--TAGTLFQRSMADLVVTLLKKEPFYVRCIKPNDLK 591

  Fly   769 RAGKIDAPLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYELLT----PNVIPKGFMDGKKA 829
            .:...|...|..|:|..|:||.:|:.|.||.:|..:.:|..||::::    ||.......||.:.
  Fly   592 SSTVFDEERVEHQVRYLGLLENLRVRRAGFVHRQRYDKFLLRYKMISQYTWPNFRAGSDRDGVRV 656

  Fly   830 CEKMIQALELDSNLYRVGQSKIFFRA-GVLAHLEEERDFKISDLIVNFQAFCRGFLARRNYQKRL 893
               :|:..:...:: :.|.:|||.|: ..|..||.:|:..|..::...|...||::.|||::|  
  Fly   657 ---LIEEKKFAQDV-KYGHTKIFIRSPRTLFALEHQRNEMIPHIVTLLQKRVRGWIVRRNFKK-- 715

  Fly   894 QQLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLLEVTKQEEKLVQKEDELKQVREKLDTLA--K 956
              :.|...|.|...|| |||::           :.|:..:..|..|..|..|.::.....||  |
  Fly   716 --MKAAITIVRAYKAY-KLRSY-----------VQELANRLRKAKQMRDYGKSIQWPQPPLAGRK 766

  Fly   957 NTQEYERKYQ----QALVEKTTLAEQLQAEIELCAEAEESRSRL---MARKQELEDMMQELETRI 1014
            ...:..|.:.    ..::.|...:|..|..:::.|....:..|.   .||:. :.|.:..     
  Fly   767 VEAKLHRMFDFWRANMILHKYPRSEWPQLRLQIIAATALAGRRPYWGQARRW-VGDYLAN----- 825

  Fly  1015 EEEEERVLALGGEKKKLELNIQDLEEQLEEEEAARQKLQLEKVQLDAKIKKY-------EEDLAL 1072
            .:|.....|..|..|.:..:..|.|             ..::|...:.:||:       .....:
  Fly   826 SQENSGYEAYNGSIKNIRNHPADGE-------------TFQQVLFSSFVKKFNHFNKQANRAFIV 877

  Fly  1073 TDDQNQKL--LKEKKLLEERANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERL---HKDQQQ 1132
            :|....||  :|.|      ..|:.:|:           |::.....::|...::|   |.    
  Fly   878 SDSTIHKLDGIKNK------FKDMKRTI-----------KIRELTSISVSPGRDQLIVFHS---- 921

  Fly  1133 RQESDRSKRK-----IETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRID 1183
                  ||.|     :|:|...|||.      ::.|:...:.|:..:||.|.||::
  Fly   922 ------SKNKDLVFSLESEYTPLKED------RIGEVVGIVCKKYHDLTGTELRVN 965

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zipNP_523860.2 Myosin_N 80..117 CDD:280832
Myosin_head 133..854 CDD:278492 253/739 (34%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 250/727 (34%)
Myosin_tail_1 931..2011 CDD:279860 51/280 (18%)
Prefoldin 1431..1515 CDD:298833
FAM76 <1847..1926 CDD:292665
Myo31DFNP_001188784.1 MYSc 6..690 CDD:214580 258/752 (34%)
MYSc_Myo1 21..677 CDD:276829 250/727 (34%)
Myosin_TH1 801..983 CDD:283635 40/218 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C103685586
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.