DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zip and Myh6

Sequence 1:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster
Sequence 2:NP_058935.2 Gene:Myh6 RGDID:62029 Length:1939 Species:Rattus norvegicus

Alignment Length:1951 Identity:763/1952 (39%)
Similarity:1184/1952 (61%) Gaps:76/1952 (4%)


  Fly    83 WVPHENQGFVAASIKREHGDEVEVELAETGKRVMILRDDIQKMNPPKFDKVEDMAELTCLNEASV 147
            :||.:.:.:|.|.|....|.:|..| .|.||.|.:..|.:.:.|||||||:||||.||.|:|.:|
  Rat    38 FVPDDKEEYVKAKIVSREGGKVTAE-TENGKTVTVK
EDQVMQQNPPKFDKIEDMAMLTFLHEPAV 101

  Fly   148 LHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNML 212
            |:|:|:||.:.:||||||||||.|||||.||:|..:::..|:|.||.|.|||:|:|:|:||:.||
  Rat   102 LYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYML 166

  Fly   213 GDREDQSILCTGESGAGKTENTKKVIQFLAYVAASKPKGSGAVPHPAVLINFSVNTNKYIKVKIM 277
            .|||:||||.|||||||||.|||:|||:.|.:||.                              
  Rat   167 TDRENQSILITGESGAGKTVNTKRVIQYFASIAAI------------------------------ 201

  Fly   278 AQNQNQTIEVVNGLKMVEVNSNCQEGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFD 342
                        |.:..:.|.|..:|.||.|::||||.||||||||||:|||||||||||||:|.
  Rat   202 ------------GDRSKKDNPNANKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFG 254

  Fly   343 ASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGATPEQREKFIL-DDVKSYAFLSNGSL 406
            |:|.::.|:||||||||||.|.|.|.||.:|||||:|:...||..:..:: ::...|||:|.|.:
  Rat   255 ATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEV 319

  Fly   407 PVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSAVLLFGSMKFRQERNNDQATLPDNTV-AQ 470
            .|..:||..|..||..:.:::|.|:|:...::::..|::.:|:|||:|::..:||. ||.|. |.
  Rat   320 SVASIDDSEELLATDSAFDVLGFTAEEKAGVYKLTGAIMHYGNMKFKQKQREEQAE-PDGTEDAD 383

  Fly   471 KIAHLLGLSVTDMTRAFLTPRIKVGRDFVTKAQTKEQVEFAVEAIAKACYERMFKWLVNRINRSL 535
            |.|:|:||:..|:.:....||:|||.::|||.|:.:||.:::.|:||:.||:||.|:|.|||.:|
  Rat   384 KSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKSVYEKMFNWMVTRINATL 448

  Fly   536 DRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWKFI 600
            : ||:....|||:||:||||||:.|||||||||:|||||||.|||.||:||||||::|||||:||
  Rat   449 E-TKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFI 512

  Fly   601 DFGLDLQPTIDLIDKPGGIMALLDEECWFPKATDKTFVDKLVSAH-SMHPKFMKTDFRGV----- 659
            |||:|||..||||:||.|||::|:|||.||||||.||..||...| .....|.|.  |.|     
  Rat   513 DFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNFQKP--RNVKGKQE 575

  Fly   660 ADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVVNIWKDAEIVGMAQQALTDT-- 722
            |.|::|||||.|||:...||.||.|||||.:|.|.|.|....:..::        :..|..||  
  Rat   576 AHFSLVHYAGTVDYNILGWLEKNKDPLNETVVGLYQKSSLKLMATLF--------STYASADTGD 632

  Fly   723 ---QFGARTRKGMFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRC 784
               ..|.:.:...|:|||.|::|.|.|||..||.|:|:||||||||..|..|.:|.|||:.||||
  Rat   633 SGKGKGGKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRC 697

  Fly   785 NGVLEGIRICRQGFPNRIPFQEFRQRYELLTPNVIPKG-FMDGKKACEKMIQALELDSNLYRVGQ 848
            |||||||||||:||||||.:.:|||||.:|.|..||:| |:|.:|..||::.:|::|.|.|:.|.
  Rat   698 NGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGH 762

  Fly   849 SKIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGFLARRNYQKRLQQLNAIRIIQRNCAAYLKLR 913
            :|:||:||:|..|||.||.::|.:|...||..||.|.|..::|.:::.:|:.:||.|..|::.::
  Rat   763 TKVFFKAGLLGLLEEMRDERLSRIITRIQAQARGQLMRIEFKKMVERRDALLVIQWNIRAFMGVK 827

  Fly   914 NWQWWRLYTKVKPLLEVTKQEEKLVQKEDELKQVREKLDTLAKNTQEYERKYQQALVEKTTLAEQ 978
            ||.|.:||.|:||||:..:.|:::...::|..:|::.|:......:|.|.|....|.||..|..|
  Rat   828 NWPWMKLYFKIKPLLKSAETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQ 892

  Fly   979 LQAEIELCAEAEESRSRLMARKQELEDMMQELETRIEEEEERVLALGGEKKKLELNIQDLEEQLE 1043
            :|||.:..|:|||...:|:..|.:||..::|:..|:|:|||....|..:|:|||....:|::.::
  Rat   893 VQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDID 957

  Fly  1044 EEEAARQKLQLEKVQLDAKIKKYEEDLALTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHL 1108
            :.|....|::.||...:.|:|...|::|..|:...||.||||.|:|........|..||:|...|
  Rat   958 DLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTL 1022

  Fly  1109 AKLKAKHEATISELEERLHKDQQQRQESDRSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREE 1173
            .|.|.|.|..:.:||..|.::::.|.:.:|:|||:|.::...:|.:.:......:::.:|.|:|.
  Rat  1023 IKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEF 1087

  Fly  1174 ELTQTLLRIDEESATKATAQKAQRELESQLAEIQEDLEAEKAARAKAEKVRRDLSEELEALKNEL 1238
            :::|...:|::|.|.....||..:|.::::.|::|:||||:.||||.||:|.||:.|||.:...|
  Rat  1088 DISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLTRELEEISERL 1152

  Fly  1239 LDSLDTTAAQQELRSKREQELATLKKSLEEETVNHEGVLADMRHKHSQELNSINDQLENLRKAKT 1303
            .::...|:.|.|:..|||.|...:::.|||.|:.||...|.:|.||:..:..:.:|::||::.|.
  Rat  1153 EEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQ 1217

  Fly  1304 VLEKAKGTLEAENADLATELRSVNSSRQENDRRRKQAESQIAELQVKLAEIERARSELQEKCTKL 1368
            .|||.|...:.|..|:.:.:..:..::...::..:..|.|..|.:|||.|.:|:.::...:..||
  Rat  1218 KLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKL 1282

  Fly  1369 QQEAENITNQLEEAELKASAAVKSASNMESQLTEAQQLLEEETRQKLGLSSKLRQIESEKEALQE 1433
            |.|...:..||||.|...|...:...:...|:.:.::.||||.:.|..|:..|:....:.:.|:|
  Rat  1283 QTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSARHDCDLLRE 1347

  Fly  1434 QLEEDDEAKRNYERKLAEVTTQMQEIKKKAEEDA-DLAKELEEGKKRLNKDIEALERQVKELIAQ 1497
            |.||:.|||...:|.|::..:::.:.:.|.|.|| ...:||||.||:|.:.::..|..|:.:.|:
  Rat  1348 QYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAK 1412

  Fly  1498 NDRLDKSKKKIQSELEDATIELEAQRTKVLELEKKQKNFDKILAEEKAISEQIAQERDTAEREAR 1562
            ...|:|:|.::|:|:||..:::|........|:|||:||||||||.|...|:...|.:::::|||
  Rat  1413 CSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEAR 1477

  Fly  1563 EKETKVLSVSRELDEAFDKIEDLENKRKTLQNELDDLANTQGTADKNVHELEKAKRALESQLAEL 1627
            ...|::..:....:|:.:.:|..:.:.|.||.|:.||....|...||||||||.::.||.:..||
  Rat  1478 SLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLEL 1542

  Fly  1628 KAQNEELEDDLQLTEDAKLRLEVNMQALRSQFERDLLAKEEGAEEKRRGLVKQLRDLETELDEER 1692
            ::..||.|..|:..|...||.::....::::.||.|..|:|..|:.:|..::.:..|:|.||.|.
  Rat  1543 QSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAET 1607

  Fly  1693 KQRTAAVASKKKLEGDLKEIETTMEMHNKVKEDALKHAKKLQAQVKDALRDAEEAKAAKEELQAL 1757
            :.|..|:..|||:||||.|:|..:...|::..:|.||.|..||.:||.....::|..|.::|:..
  Rat  1608 RSRNEALRVKKKMEGDLNEMEIQLSQANRIASEAQKHLKNAQAHLKDTQLQLDDAVRANDDLKEN 1672

  Fly  1758 SKEAERKVKALEAEVLQLTEDLASSERARRAAETERDELAEEIANNANKGSLMIDEKRRLEARIA 1822
            ....||:...|:||:.:|...:..:||:|:.||.|..|.:|.:....::.:.:|::|::::|.::
  Rat  1673 IAIVERRNTLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLS 1737

  Fly  1823 TLEEELEE---EQSNSEVLLDRSRKAQLQIEQLTTELANEKSNSQKNENGRALLERQNKELKAKL 1884
            .|:.|:||   |..|:|   ::::||......:..||..|:..|...|..:..:|:..|:|:.:|
  Rat  1738 QLQTEVEEAVQECRNAE---EKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRL 1799

  Fly  1885 AEIETAQRTKVKATIATLEAKIANLEEQLENEGKERLLQQKANRKMDKKIKELTMNIEDERRHVD 1949
            .|.|.......|..:..|||::..||.:||.|.|......|..||.:::|||||...|::::::.
  Rat  1800 DEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLV 1864

  Fly  1950 QHKEQMDKLNSRIKLLKRNLDETEEELQKEKTQKRKYQRECEDMIESQEAMNREINSLKTKLRRT 2014
            :.::.:|||..::|..||..:|.||:.....::.||.|.|.::..|..:....::|.|:.|.|..
  Rat  1865 RLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSRDI 1929

  Fly  2015 G 2015
            |
  Rat  1930 G 1930

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zipNP_523860.2 Myosin_N 80..117 CDD:280832 12/34 (35%)
Myosin_head 133..854 CDD:278492 369/735 (50%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 361/723 (50%)
Myosin_tail_1 931..2011 CDD:279860 340/1084 (31%)
Prefoldin 1431..1515 CDD:298833 31/85 (36%)
FAM76 <1847..1926 CDD:292665 22/79 (28%)
Myh6NP_058935.2 Myosin_N 35..72 CDD:280832 12/35 (34%)
Myosin_head 87..768 CDD:278492 369/735 (50%)
MYSc_class_II 99..768 CDD:276951 361/723 (50%)
Actin-binding 657..679 16/22 (73%)
Actin-binding 759..773 7/14 (50%)
Calmodulin-binding. {ECO:0000250} 790..807 7/17 (41%)
Calmodulin-binding. {ECO:0000250} 816..833 7/17 (41%)
Myosin_tail_1 848..1925 CDD:279860 339/1080 (31%)
MM_CoA_mutase <1134..1295 CDD:294532 51/161 (32%)
MIT_CorA-like <1297..>1409 CDD:294313 33/112 (29%)
TMPIT 1742..>1832 CDD:285135 28/93 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000023
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126577
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.