DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zip and Myh9l1

Sequence 1:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster
Sequence 2:NP_037326.2 Gene:Myh9l1 RGDID:3140 Length:1960 Species:Rattus norvegicus

Alignment Length:2008 Identity:1200/2009 (60%)
Similarity:1547/2009 (77%) Gaps:69/2009 (3%)


  Fly    58 KYLSVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVEVELAETGKRVMILRDDI 122
            |||.|::|..|:|..||:|..|:|||||....||..||:|.|.|:|..|||.|.||:|.:.:|||
  Rat     8 KYLYVDKNFINNPLAQADWAAKKLVWVPSTKNGFEPASLKEEVGEEAIVELVENGKKVKVNKDDI 72

  Fly   123 QKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMER 187
            ||||||||.|||||||||||||||||||:|:|||||||||||||||||:||||.||||:|:|::.
  Rat    73 QKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVDM 137

  Fly   188 YKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAASKPKGS 252
            |||.||||:|||::||||:|||:|:.||||||||||||||||||||||||||:||:||:|.    
  Rat   138 YKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSH---- 198

  Fly   253 GAVPHPAVLINFSVNTNKYIKVKIMAQNQNQTIEVVNGLKMVEVNSNCQEGELEQQLLQANPILE 317
                                                        .|...:||||:||||||||||
  Rat   199 --------------------------------------------KSKKDQGELERQLLQANPILE 219

  Fly   318 AFGNAKTVKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGA 382
            |||||||||||||||||||||||||.:|:|.|||||||||||||||||||:||||||||.||:||
  Rat   220 AFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGA 284

  Fly   383 TPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSAVLLF 447
            ....:...:|:....|.|||||.:.:||..|...||.|:::|.|||:..::...:.|::|.||..
  Rat   285 GEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLLRVISGVLQL 349

  Fly   448 GSMKFRQERNNDQATLPDNTVAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVTKAQTKEQVEFAV 512
            |::.|::|||.|||::||||.|||::||||::|||.||..||||||||||:|.|||||||.:||:
  Rat   350 GNIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAI 414

  Fly   513 EAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQL 577
            ||:|||.|||||:|||.|||::||:|||||||||||||:||||||:|||||||||||||||||||
  Rat   415 EALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQL 479

  Fly   578 FNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPG---GIMALLDEECWFPKATDKTFVD 639
            ||||||||||||||||||||.||||||||||.||||:||.   ||:|||||||||||||||:||:
  Rat   480 FNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVE 544

  Fly   640 KLVSAHSMHPKFMK-TDFRGVADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVV 703
            |:|.....||||.| ...:..|||.|:||||:|||.|.:||||||||||:||.:||..|.|.||.
  Rat   545 KVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVS 609

  Fly   704 NIWKDAE-IVGMAQQA-LTDTQF-GA-RTRKGMFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIP 764
            .:|||.: |:|:.|.| :::|.. || :|||||||||..||||||||||.|||||||||||||||
  Rat   610 ELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIP 674

  Fly   765 NHEKRAGKIDAPLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYELLTPNVIPKGFMDGKKA 829
            ||||:|||:|..|||||||||||||||||||||||||:.|||||||||:||||.|||||||||:|
  Rat   675 NHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQA 739

  Fly   830 CEKMIQALELDSNLYRVGQSKIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGFLARRNYQKRLQ 894
            |..||:||||||||||:||||:|||||||||||||||.||:|:|:.|||.|||:|||:.:.||.|
  Rat   740 CVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQ 804

  Fly   895 QLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLLEVTKQEEKLVQKEDELKQVREKLDTLAKNTQ 959
            ||.|::::||||||||:|||||||||:|||||||...:.|::|:.||.||.:||||.........
  Rat   805 QLTAMKVLQRNCAAYLRLRNWQWWRLFTKVKPLLNSIRHEDELLAKEAELTKVREKHLAAENRLT 869

  Fly   960 EYERKYQQALVEKTTLAEQLQAEIELCAEAEESRSRLMARKQELEDMMQELETRIEEEEERVLAL 1024
            |.|....|.:.||..|.||||||.||||||||.|:||.|:|||||::..:||.|:||||||...|
  Rat   870 EMETMQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQYL 934

  Fly  1025 GGEKKKLELNIQDLEEQLEEEEAARQKLQLEKVQLDAKIKKYEEDLALTDDQNQKLLKEKKLLEE 1089
            ..||||::.|||:|||||||||:||||||||||..:||:||.|||..:.:|||.||.|||||||:
  Rat   935 QAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEDQIIMEDQNCKLAKEKKLLED 999

  Fly  1090 RANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERLHKDQQQRQESDRSKRKIETEVADLKEQL 1154
            |..:.:..|.|||||:|.|||||.||||.|::|||||.::::||||.::::||:|.:..||.:|:
  Rat  1000 RVAEFTTNLMEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQI 1064

  Fly  1155 NERRVQVDEMQAQLAKREEELTQTLLRIDEESATKATAQKAQRELESQLAEIQEDLEAEKAARAK 1219
            .|.:.|:.|::.||||:||||...|.|::||:|.|..|.|..||||:|::|:|||||:|:|.|.|
  Rat  1065 AELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELETQISELQEDLESERACRNK 1129

  Fly  1220 AEKVRRDLSEELEALKNELLDSLDTTAAQQELRSKREQELATLKKSLEEETVNHEGVLADMRHKH 1284
            |||.:|||.|||||||.||.|:||:||||||||||||||::.|||:||:|...||..:.:||.||
  Rat  1130 AEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVSILKKTLEDEAKTHEAQIQEMRQKH 1194

  Fly  1285 SQELNSINDQLENLRKAKTVLEKAKGTLEAENADLATELRSVNSSRQENDRRRKQAESQIAELQV 1349
            ||.:..:.:|||..::.|..|||||.|||.|..:||.|::::...:.:::.:||:.|:|:.||||
  Rat  1195 SQAVEELAEQLEQTKRVKATLEKAKQTLENERGELANEVKALLQGKGDSEHKRKKVEAQLQELQV 1259

  Fly  1350 KLAEIERARSELQEKCTKLQQEAENITNQLEEAELKASAAVKSASNMESQLTEAQQLLEEETRQK 1414
            |.:|.||.|:||.:|.:|||.|.:::|..|.:::.|:|...|..|.:||||.:.|:||:||.|||
  Rat  1260 KFSEGERVRTELADKVSKLQVELDSVTGLLNQSDSKSSKLTKDFSALESQLQDTQELLQEENRQK 1324

  Fly  1415 LGLSSKLRQIESEKEALQEQLEEDDEAKRNYERKLAEVTTQMQEIKKKAEEDADLAKELEEGKKR 1479
            |.||:||:|:|.||.:.:|||||::|||||.|:::|.:..|:.::|||.|:.....:..||.|:|
  Rat  1325 LSLSTKLKQMEDEKNSFREQLEEEEEAKRNLEKQIATLHAQVTDMKKKMEDGVGCLETAEEAKRR 1389

  Fly  1480 LNKDIEALERQVKELIAQNDRLDKSKKKIQSELEDATIELEAQRTKVLELEKKQKNFDKILAEEK 1544
            |.||:|.|.::::|.:|..|:|:|:|.::|.||:|..::|:.||..|..||||||.||::|||||
  Rat  1390 LQKDLEGLSQRLEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLEKKQKKFDQLLAEEK 1454

  Fly  1545 AISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKIEDLENKRKTLQNELDDLANTQGTADKN 1609
            .||.:.|:|||.||.||||||||.||::|.|:||.::..:||...|..:.|::||.:::....|:
  Rat  1455 TISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKS 1519

  Fly  1610 VHELEKAKRALESQLAELKAQNEELEDDLQLTEDAKLRLEVNMQALRSQFERDLLAKEEGAEEKR 1674
            ||||||:|||||.|:.|:|.|.|||||:||.|||||||||||:||:::||||||..::|.:|||:
  Rat  1520 VHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKK 1584

  Fly  1675 RGLVKQLRDLETELDEERKQRTAAVASKKKLEGDLKEIETTMEMHNKVKEDALKHAKKLQAQVKD 1739
            :.||:|:|::|.||::|||||:.|:|::||||.|||::|..::..||.:|:|:|..:|||||:||
  Rat  1585 KQLVRQVREMEAELEDERKQRSIAMAARKKLEMDLKDLEAHIDTANKNREEAIKQLRKLQAQMKD 1649

  Fly  1740 ALRDAEEAKAAKEELQALSKEAERKVKALEAEVLQLTEDLASSERARRAAETERDELAEEIANNA 1804
            .:|:.::.:|::||:.|.:||.|:|:|::|||::||.|:||::|||:|.|:.||||||:||||::
  Rat  1650 CMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSS 1714

  Fly  1805 NKGSLMIDEKRRLEARIATLEEELEEEQSNSEVLLDRSRKAQLQIEQLTTELANEKSNSQKNENG 1869
            .||:|.::||||||||||.|||||||||.|:|::.||.:||.|||:|:.|:|..|:|::|||||.
  Rat  1715 GKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENA 1779

  Fly  1870 RALLERQNKELKAKLAEIETAQRTKVKATIATLEAKIANLEEQLENEGKERLLQQKANRKMDKKI 1934
            |..||||||||||||.|:|:|.::|.||:||.||||||.|||||:||.|||....|..|:.:||:
  Rat  1780 RQQLERQNKELKAKLQEMESAVKSKYKASIAALEAKIAQLEEQLDNETKERQAASKQVRRAEKKL 1844

  Fly  1935 KELTMNIEDERRHVDQHKEQMDKLNSRIKLLKRNLDETEEELQKEKTQKRKYQRECEDMIESQEA 1999
            |::.:.:|||||:.:|.|:|.||.::|:|.|||.|:|.|||.|:....:||.|||.||..|:.:|
  Rat  1845 KDVLLQVEDERRNAEQFKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADA 1909

  Fly  2000 MNREINSLKTKLRRTGGIGLSSSRLTGTPSSKRAGGGGGGDDSSVQDESLDGE-DSAN 2056
            ||||::|||.|||| |.:....:|        |....|.||.|   ||.:||: |.|:
  Rat  1910 MNREVSSLKNKLRR-GDMPFVVTR--------RIVRKGTGDCS---DEEVDGKADGAD 1955

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zipNP_523860.2 Myosin_N 80..117 CDD:280832 20/37 (54%)
Myosin_head 133..854 CDD:278492 500/729 (69%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 488/717 (68%)
Myosin_tail_1 931..2011 CDD:279860 585/1080 (54%)
Prefoldin 1431..1515 CDD:298833 36/84 (43%)
FAM76 <1847..1926 CDD:292665 51/79 (65%)
Myh9l1NP_037326.2 Myosin_N 30..68 CDD:280832 20/38 (53%)
Myosin_head 83..764 CDD:278492 500/729 (69%)
Motor_domain 95..764 CDD:277568 488/717 (68%)
Myosin_tail_1 842..1921 CDD:279860 585/1079 (54%)
UBAN 1038..1149 CDD:301588 59/111 (53%)
RRF <1206..1261 CDD:294170 23/55 (42%)
RILP-like <1480..1587 CDD:304877 57/107 (53%)
DUF2390 <1610..1678 CDD:295281 31/68 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 2307 1.000 Inparanoid score I29
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000023
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126577
Panther 1 1.100 O PTHR45615
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.920

Return to query results.
Submit another query.