DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zip and LOC101733223

Sequence 1:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster
Sequence 2:XP_017945558.1 Gene:LOC101733223 ID: Length:602 Species:Xenopus tropicalis

Alignment Length:632 Identity:426/633 (67%)
Similarity:503/633 (79%) Gaps:34/633 (5%)


  Fly    46 MSEEVDRNDPELKYLSVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVEVELAE 110
            ||:...:.||| :||.|:|:...:|.|||:||.|:|||||.|..||.|||||.|.|:||.|||||
 Frog     1 MSQRSGQEDPE-RYLFVDRDVVYNPTTQADWTAKKLVWVPSERHGFEAASIKEERGEEVVVELAE 64

  Fly   111 TGKRVMILRDDIQKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYK 175
            .||:.|:.:|||||||||||.|||||||||||||||||||:|||||||||||||||||||:||||
 Frog    65 NGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYK 129

  Fly   176 KLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQF 240
            .||||:|.|:|.|:|.||||:|||::||::||||.||.||||||||||||||||||||||||||:
 Frog   130 NLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQY 194

  Fly   241 LAYVAASKPKGSGAVPHPAVLINFSVNTNKYIKVKIMAQNQNQTIEVVNGLKMVEVNSNCQEGEL 305
            ||:||:|. ||                            .::.||...:...|...:.:...|||
 Frog   195 LAHVASSH-KG----------------------------KKDHTIPTESPKAMKHQSGSLLYGEL 230

  Fly   306 EQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDER 370
            |:||||||||||:||||||||||||||||||||||||.:|:|.||||||||||||||||||||||
 Frog   231 ERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDER 295

  Fly   371 TFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFN 435
            |||||||||||:....:...:||...:|.|:|||.:|:||..|...||.|:::|:|||.:.|:..
 Frog   296 TFHIFYQLLAGSGEHLKSDLLLDGFNNYRFVSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEIL 360

  Fly   436 SIFRIVSAVLLFGSMKFRQERNNDQATLPDNTVAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVT 500
            |:.::|||||.||::.|::|||.|||::|:||.|||:.|||||::.:.|||.||||||||||:|.
 Frog   361 SMLKVVSAVLQFGNITFKKERNTDQASMPENTAAQKLCHLLGLNIMEFTRAILTPRIKVGRDYVQ 425

  Fly   501 KAQTKEQVEFAVEAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQL 565
            |||||||.:|||||:|||.|||:|:|||:|||::||||||||||||||||:||||||||||||||
 Frog   426 KAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQL 490

  Fly   566 CINYTNEKLQQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPG---GIMALLDEEC 627
            ||||||||||||||||||||||||||||||||.||||||||||.||||::|.   |::|||||||
 Frog   491 CINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEEC 555

  Fly   628 WFPKATDKTFVDKLVSAHSMHPKFMK-TDFRGVADFAIVHYAGRVDY 673
            ||||||||:||||||.. ..|.||.| ...:..|||.|:||||||||
 Frog   556 WFPKATDKSFVDKLVQEXGTHSKFQKPRQLKDKADFCIIHYAGRVDY 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zipNP_523860.2 Myosin_N 80..117 CDD:280832 25/37 (68%)
Myosin_head 133..854 CDD:278492 373/546 (68%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 361/534 (68%)
Myosin_tail_1 931..2011 CDD:279860
Prefoldin 1431..1515 CDD:298833
FAM76 <1847..1926 CDD:292665
LOC101733223XP_017945558.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000023
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.