DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3829 and santa-maria

Sequence 1:NP_001286874.1 Gene:CG3829 FlyBaseID:FBgn0035091 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster

Alignment Length:506 Identity:127/507 (25%)
Similarity:233/507 (46%) Gaps:56/507 (11%)


  Fly    95 VISVTGFFV--------MWFTEYYNNTILENLILAENSDTANSWLNPDPKYDTLLKAHIFHYPNI 151
            :|.:.||.:        |::.:.::..:.:.:.||.::....:|  ..|..|..|..:::::.|.
  Fly    18 IIGIFGFCLGLFGILCGMFWVDLFDWIMHKEMALAPDTRVYENW--KSPPIDLSLDIYLYNWTNP 80

  Fly   152 DDYLAGRADKIKVVDVGPLTYQEHTVKDEVSFN-KNFTVSFRDRKSYKFLPEKSSIGEHEVVRVP 215
            :|: ...:.|..:..|||..:.|...|.::.:: :|.:|::|.|..:.|....|:....:.:...
  Fly    81 EDF-GNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLDDEITTL 144

  Fly   216 NVPLISAAGPVKRMKAFERLAVSTWIKQFKEPLFKNLTVSEYLW-GYEDSII----KLKSLGRGR 275
            |...:|||...|.....:|..|...:|.:...:....::.|.|: ||.|::|    .:...|...
  Fly   145 NAVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGDEV 209

  Fly   276 R----RFGLLMSRNGTSVDSVQLN--TGEDDITKFSIITQFNGMPQLDYWEGDECNRIDGSEPSM 334
            :    :||...:|||::..:...|  ||.|.:.|...:..:|......::: ..|...:|| ...
  Fly   210 KVPFDKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFD-SYCGMTNGS-AGE 272

  Fly   335 FSPHLLQDRSTVNVFLQVLCRKVPLHFEKEVTIYNDIDVLR-YR---TPMDVFSHPSKNPANQCY 395
            |.|..|:...:|.:|...:||.:||.:.:.|    ||:.|. |:   .|..| .:.::.|.|.|:
  Fly   273 FQPQHLKPGDSVGLFTPDMCRTIPLDYVETV----DIEGLEGYKFSGGPRSV-DNGTQYPENLCF 332

  Fly   396 CQNTELCLPSGVINATKCYGDAPIFPSFPHFFTGDPVLYQDFEGIEPDAAVHQTYADIHPRFGFP 460
            |...  |:||||:|.:.|...:|:|.|:||||..||......||:.|:...|:.|..:.|..|.|
  Fly   333 CGGQ--CVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIP 395

  Fly   461 ISGASRVQINIMLDKTPILRNQGDRLKN---TTILPLMWIE----ITSGDFSEE--VLHTLYLST 516
            :..|:|.|:|::::  ||   ||..|..   ....||:|.|    ||. |.:::  ||..:.||.
  Fly   396 LEVAARFQVNMLVE--PI---QGISLYTGIPRIFFPLVWFEQKVRITP-DMADQLKVLPIVMLSG 454

  Fly   517 FGLNAIQQTLKYGTLLISVTSFSLIVAGVYYLNSRREQQLQESKTSAELEA 567
            .....|  .|..|..|:..|...:::|.   ..:||.....::||:.:.::
  Fly   455 HIFAGI--CLIVGITLLCWTPVQILLAS---CRNRRYDLRTKTKTNGQYKS 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3829NP_001286874.1 CD36 91..546 CDD:279474 123/484 (25%)
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 121/471 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50693373
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I2712
Isobase 1 0.950 1.030639 Normalized mean entropy S6187
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.