DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: emp and CG31741

Sequence 1:NP_726504.2 Gene:emp FlyBaseID:FBgn0010435 Length:551 Species:Drosophila melanogaster
Sequence 2:NP_724088.2 Gene:CG31741 FlyBaseID:FBgn0051741 Length:491 Species:Drosophila melanogaster

Alignment Length:494 Identity:124/495 (25%)
Similarity:227/495 (46%) Gaps:33/495 (7%)


  Fly    49 RKWWITIVVAAALIIGGIVVACEFTVLIDAVVDRMVALRPGAKTFGWWAKPPVEPRISLYIYNVT 113
            :|.|:..:....|.| ||.:|..:..:....:..::.|.|.:..:..|...|.....:::::|.|
  Fly    11 QKIWVFSMGGLILAI-GIFLASAWPAVSRQWIRSLLPLAPNSFIYNRWVTTPTPVYSTVFLFNWT 74

  Fly   114 NADDFLSNGSKAIVDEVGPYVYSETWEKVNIVENDNGTLSYNLRKIYSFREDLSVGPEDDVVIVP 178
            |..|..:.|.|...:::|||.:|:...|.:: |.:...::|..::.:.|..:.|.|..|||||.|
  Fly    75 NPGDLNTEGVKPHFEQLGPYTFSDFKVKEDL-EWNQPQVTYFGKRTWHFLPEKSNGSLDDVVIAP 138

  Fly   179 NIPMLSATSQSKHAARFLRLAMASIMDILKIKPFVQVSVGQLLW-GYEDPLLKLAKDVVPKEQKL 242
            :.|.|:|...|:...|.||..|...::.......:..:.||.|: ||.|.||...:.:  ....|
  Fly   139 HFPTLTAALYSRRLRRILRKVMNFTLNREGGATHMTHTAGQWLFDGYYDHLLDFVEQL--HSPLL 201

  Fly   243 P-YEE-FGLLYGKNG--TSSDRVTVNTGVDDIRRYGIIDNFNGRTHLPHWTTDACNTLAGTDGSI 303
            | |:. ||..|.:|.  |:....|::||..|:.:.|.:..:||......:..: |..:.|:.|.:
  Fly   202 PVYDNTFGWFYERNNSKTAEGNFTLHTGRGDLSQLGDLLLWNGENTTGFYPGE-CGKVNGSTGEL 265

  Fly   304 FPPHIDHDRILHVYDKDLCRLLPLVFEKEVMTSNEVPGYRFTPPEWVFADVDSHPDNMCFCPAGK 368
            :.|:...|:...::..|..|.|.| |.||.:|.:.:..:|:........:....||..|||...:
  Fly   266 WSPYRTWDQPTTIFLPDAARYLNL-FPKENLTIDGIDVWRYESTNLTIDNGQLSPDTECFCLKNR 329

  Fly   369 PSCSPNGLFNVSLCQYDSPIMLSFPHFYLADESLRTQVEGISPPMKEKHQFFFDVQPKMGTTLRV 433
             .|..||:.:.....::.|..:|.|||:|.|:..|....|:.|...| |..:..::|.:|..|.:
  Fly   330 -ECPRNGVLDYGPPAFNGPFYMSHPHFFLTDQMYRENTTGLQPEESE-HGMYVIMEPTLGIPLSL 392

  Fly   434 RARIQINLAV--SQVFDI-KQVANFPDIIFPILWFEEGIDNLPDEVTDLMRFAEQVPPKIRVALI 495
            |.::.|:..|  .:..|: |.||.  |...|:.......: |.:.:|.|::.|      :..|:|
  Fly   393 RGQLMISTKVVRDEAIDLFKNVAY--DHYAPLFTMRLHAE-LDEGLTKLLKLA------LNAAII 448

  Fly   496 -----VGLCALGVILLLLSTFCLIR---NSHRQSTLHLE 526
                 :||..||:.:::...|...:   :|.::...||:
  Fly   449 GMYTGIGLVLLGMSIVVTGIFITKKHKWHSEQRPDKHLQ 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
empNP_726504.2 CD36 58..511 CDD:279474 118/466 (25%)
CG31741NP_724088.2 CD36 21..469 CDD:279474 118/465 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50683082
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.