DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and SCARB2

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_005497.1 Gene:SCARB2 HGNCID:1665 Length:478 Species:Homo sapiens

Alignment Length:511 Identity:126/512 (25%)
Similarity:187/512 (37%) Gaps:121/512 (24%)


  Fly    11 LCLILACVNVFLFVV---SWGVDYRILVAREHIRFRQEMPTMDSWINSPFGKLKN-YVFNVTNAE 71
            |.|:|...:|.|.|.   ...||..|   .:.|..|......|||...|...... |.|||||.|
Human    12 LSLLLLVTSVTLLVARVFQKAVDQSI---EKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPE 73

  Fly    72 EFRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETNVRYRKH-------RYRVVEFLPEESVAP-- 127
            |...|...|  |:|:||..||.:       ||:.|:::..:       ..:...|..::||..  
Human    74 EILRGETPR--VEEVGPYTYREL-------RNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPK 129

  Fly   128 ------------DVLNWTITSTNNVILGAATKVKHTAPLAAFGFDAALMMEDIFVTDSVYYFLWE 180
                        .|:.|:.......|:.|..|.               ..:.:|||.:|...||.
Human   130 IDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKA---------------YQQKLFVTHTVDELLWG 179

  Fly   181 FTRPLLQTLSRISNIRPNVAVLYNALKEKEEV----YTVNIGPKRGIENFFRIETLNGEVIIREQ 241
            :..   :.||.|...||:::..:....||...    |....|....: ||.:|...||:..:   
Human   180 YKD---EILSLIHVFRPDISPYFGLFYEKNGTNDGDYVFLTGEDSYL-NFTKIVEWNGKTSL--- 237

  Fly   242 LPHTRQYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRY- 305
                ..:.::.|  |:....|...|.|.:..|..|.:...:.||.:.:|:...|...||..||| 
Human   238 ----DWWITDKC--NMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYK 296

  Fly   306 ----TLLQSHQKPPGCLDTSYGVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYEGYTP 366
                .|..:......|:..  |..|..|:.:||.|. |.||...|.||||.:...:....||..|
Human   297 VPAEILANTSDNAGFCIPE--GNCLGSGVLNVSICK-NGAPIIMSFPHFYQADERFVSAIEGMHP 358

  Fly   367 NAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIPSFWYEFEMGQLPGFV 431
            |.||||.::.:.|:|||.:....|||.||.:..|..|                  .|.|.:...|
Human   359 NQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDF------------------VETGDIRTMV 405

  Fly   432 TSLMWINVNIVQHIQ--------------------PYCM----VLFLVLALWSVLK 463
            ..:|::|.::  ||.                    ||.:    |.|.::..|...|
Human   406 FPVMYLNESV--HIDKETASRLKSMINTTLIITNIPYIIMALGVFFGLVFTWLACK 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 125/509 (25%)
SCARB2NP_005497.1 CD36 28..455 CDD:307331 118/490 (24%)
Important for interaction with GBA 155..191 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.