DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and RGD1565355

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001102688.1 Gene:RGD1565355 RGDID:1565355 Length:472 Species:Rattus norvegicus

Alignment Length:401 Identity:97/402 (24%)
Similarity:165/402 (41%) Gaps:74/402 (18%)


  Fly    63 YVFNVTNAEEFRSGRDSRLKVKEIGPIVYRI---VGFNDILDRNETNVRYRKHRYRVVEFLPEES 124
            ::|:|.|.||. :...|::|||:.||..||:   ...|...|..::.|.:.:....:.|  |..|
  Rat    66 WIFDVQNPEEV-AKNSSKIKVKQRGPYTYRVRYLAKENITQDPKDSTVSFVQPNGAIFE--PSLS 127

  Fly   125 VAPDVLNWTITSTNNVILGAATKVKHTAPLAAFGFDAALM-------MEDIFVTDSVYYFLWEFT 182
            |..:..|:|:.   |:.:.||..:...:      |...::       ...:|.|.|:...||.:.
  Rat   128 VGTENDNFTVP---NLAVAAAPHIYQNS------FIQGVLNNLIKKSKSSMFQTRSLKELLWGYK 183

  Fly   183 RPLLQTLSRISNIRPNVAVLYNALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLPHTRQ 247
            .|.|..:.  ..|...|.|.|......:.||.|..| |..|.....|:|..|    :..|.:.:.
  Rat   184 DPFLSLIP--YPISTTVGVFYPYNNTVDGVYKVFNG-KDNINKVAIIDTYKG----KRNLSYWKS 241

  Fly   248 YDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRYTL----- 307
            |    |.. ::|. |.:.|||||:....|...:.:.||.:...::.:....|:..:|:.|     
  Rat   242 Y----CDM-INGT-DAASFPPFVEKSRTLRFFSPDICRSIYAVFESEVNLKGIPVYRFVLPVNAF 300

  Fly   308 ---LQSHQKPPGCLD-------TSYGVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYE 362
               ||:......|.:       |||||      .|:.:|. ...|...|:|||..:|.:.|:..:
  Rat   301 ASPLQNPDNHCFCTEKVISNNCTSYGV------LDIGKCK-EGKPVYISLPHFLHASPDVSEPIQ 358

  Fly   363 GYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIPSFWYEFEMGQL 427
            |..||.::|..|:.:||:||..:....|.|.||.:...|    ::....|:..|           
  Rat   359 GLNPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPAR----KIEALRNLKRP----------- 408

  Fly   428 PGFVTSLMWIN 438
              ::..::|:|
  Rat   409 --YIVPILWLN 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 97/402 (24%)
RGD1565355NP_001102688.1 CD36 16..461 CDD:279474 97/402 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.