| Sequence 1: | NP_611991.1 | Gene: | CG2736 / 37998 | FlyBaseID: | FBgn0035090 | Length: | 507 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001102688.1 | Gene: | RGD1565355 / 499985 | RGDID: | 1565355 | Length: | 472 | Species: | Rattus norvegicus | 
| Alignment Length: | 401 | Identity: | 97/401 - (24%) | 
|---|---|---|---|
| Similarity: | 165/401 - (41%) | Gaps: | 74/401 - (18%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    63 YVFNVTNAEEFRSGRDSRLKVKEIGPIVYRI---VGFNDILDRNETNVRYRKHRYRVVEFLPEES 124 
  Fly   125 VAPDVLNWTITSTNNVILGAATKVKHTAPLAAFGFDAALM-------MEDIFVTDSVYYFLWEFT 182 
  Fly   183 RPLLQTLSRISNIRPNVAVLYNALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLPHTRQ 247 
  Fly   248 YDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRYTL----- 307 
  Fly   308 ---LQSHQKPPGCLD-------TSYGVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYE 362 
  Fly   363 GYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIPSFWYEFEMGQL 427 
  Fly   428 PGFVTSLMWIN 438 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG2736 | NP_611991.1 | CD36 | 10..462 | CDD:279474 | 97/401 (24%) | 
| RGD1565355 | NP_001102688.1 | CD36 | 16..461 | CDD:279474 | 97/401 (24%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166342085 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3776 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1106566at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.750 | |||||