DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and Snmp1

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001262803.1 Gene:Snmp1 FlyBaseID:FBgn0260004 Length:551 Species:Drosophila melanogaster

Alignment Length:512 Identity:119/513 (23%)
Similarity:201/513 (39%) Gaps:102/513 (20%)


  Fly     4 VQWVKILLCLILACVNVFLFVVSWGVDYRIL--VAREHIRFRQEMPTMDSWINSPFG-KLKNYVF 65
            :|..::.|.:....:.||..:..|.:..:||  :..:.:..:......:.|.|:||. ....|||
  Fly     1 MQVPRVKLLMGSGAMFVFAIIYGWVIFPKILKFMISKQVTLKPGSDVRELWSNTPFPLHFYIYVF 65

  Fly    66 NVTNAEEFRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETNVRYRKHRYRVVEFLPEESVAPDVL 130
            ||||.:|...|...||  :|:||.|     |::..|:.:.                |:.|..|.:
  Fly    66 NVTNPDEVSEGAKPRL--QEVGPFV-----FDEWKDKYDL----------------EDDVVEDTV 107

  Fly   131 NWT--------------ITSTNNVIL--------GAATKVKHTAPLA------------AFGFDA 161
            ::|              :|....:||        |.:.:.:..|.:.            |..|..
  Fly   108 SFTMRNTFIFNPKESLPLTGEEEIILPHPIMLPGGISVQREKAAMMELVSKGLSIVFPDAKAFLK 172

  Fly   162 ALMMEDIFVTDSVYYFLWEFTRPLLQTLSRISNIRPNVAV-----LYNALKEKEEVYTVNIGPKR 221
            |..|:..|...:|.....||:...|.|:.....|:....|     |::.:.:.....:......|
  Fly   173 AKFMDLFFRGINVDCSSEEFSAKALCTVFYTGEIKQAKQVNQTHFLFSFMGQANHSDSGRFTVCR 237

  Fly   222 GIENFFRIETLNGEVIIREQLPHTRQYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRV 286
            |::|..::    |:|:.....|....:....|  |.....|:::|.|.::.:..|.....:.||.
  Fly   238 GVKNNKKL----GKVVKFADEPEQDIWPDGEC--NTFVGTDSTVFAPGLKKEDGLWAFTPDLCRS 296

  Fly   287 LPLTYQRQERYNGLDTFRYTL----LQSHQK------PPGCLDTSYGVKLPDGMFDVSQCVINDA 341
            |...||.:..|:|:.:.||||    :::.:|      .|..|||.    .|.|..:::.||  ..
  Fly   297 LGAYYQHKSSYHGMPSMRYTLDLGDIRADEKLHCFCEDPEDLDTC----PPKGTMNLAACV--GG 355

  Fly   342 PSAFSMPHFYGSSYNWSQHYEGYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSR 406
            |...||||||..........:|..||.:||..||..|.::|.|.....|.|.|:.:..:..... 
  Fly   356 PLMASMPHFYLGDPKLVADVDGLNPNEKDHAVYIDFELMSGTPFQAAKRLQFNLDMEPVEGIEP- 419

  Fly   407 LSRFSNMMIPSFWYEFEMGQLPGFVTSLMWINVNIVQHIQPYCMVLFLVLALWSVLK 463
            :.....:::|.||.| |..||....|       |:|::      .|||.|.:.|||:
  Fly   420 MKNLPKLILPMFWVE-EGVQLNKTYT-------NLVKY------TLFLGLKINSVLR 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 117/504 (23%)
Snmp1NP_001262803.1 CD36 12..478 CDD:279474 117/502 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52869818
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.