DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and CG10345

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_650563.2 Gene:CG10345 FlyBaseID:FBgn0027562 Length:552 Species:Drosophila melanogaster

Alignment Length:485 Identity:121/486 (25%)
Similarity:204/486 (42%) Gaps:114/486 (23%)


  Fly    46 MPTMDSWINSPFGKLKNYVFNVTNAEEFRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETN--VR 108
            :|.:|.:||.       |:||.||.:||.|||.|:|:::|:||.||:.|..|..:..||:|  :.
  Fly    59 LPPLDVYINV-------YMFNYTNVDEFTSGRASKLQLQEVGPYVYKEVLSNHNVTYNESNNTIT 116

  Fly   109 YRKHRYRVVEFLPEESVAPDVLNWTITSTNNVILGAATKVKHTAPLAAFGFDAAL-------MME 166
            |...|..|  |.||.||....:: .|.:.|..::|..|.....:..||.|..|..       |:|
  Fly   117 YSPKREYV--FAPERSVGDPKID-RIRAPNIPLMGVTTLASSLSMFAALGLSAITRQLNSQPMLE 178

  Fly   167 DIFVTDSVYYFLWEFTRPLLQTLSRISNIRPN------VAVLYNALKEKEE--VYTVNI-GPK-- 220
                 .||:.::|.:...|::..||..   ||      ..::....:|..|  |:.:|: .||  
  Fly   179 -----MSVHDYMWGYEDHLVELASRFV---PNWIDFSSFGIMEKLFREGNESNVFNMNLPEPKDK 235

  Fly   221 ---------RGIENFFRIETLNGEVIIREQLPHTRQY--DSNSCPFN-VSGALDNSLFPPFVQPD 273
                     ||    :.::::|||...:..     ||  ::|....| :.|:.|.:|||..:..:
  Fly   236 YGMRMTDAPRG----YTVDSINGERGFKGW-----QYNEETNGTMCNRIWGSHDATLFPLDMDEN 291

  Fly   274 TPLSIVAIESCRVLPLTYQRQERYNGLDTFRYTLLQSHQKPPGCLDTSYGVK-----------LP 327
            ....:.....||.||:.:.|...:||||.|.:.:      .|...|:.....           |.
  Fly   292 DEFFLYRRTFCRRLPVKFNRTTTFNGLDAFEFVM------EPDSFDSEVDNANSSCYCKNNRCLK 350

  Fly   328 DGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYEGYTPNAEDHEPYILLEPVTGIPVTEKY-RF 391
            .|:.:||.|..| .|.|.:.|||..:..:..:.::|..||........:::|..|.|:...: |.
  Fly   351 KGVGNVSPCYYN-IPLAITYPHFMHADPSLLEPFDGLQPNVSRFTSTFVVQPQLGAPMQGTHLRL 414

  Fly   392 QSNIPIPDLRRFSSRLSRFSNMMIPSFWYEFEMGQLPGFVTSLMWINVNIVQHIQPYCMVLFLVL 456
            |:|..:..: .|:..::.|.||::|                 |:|:::|    |...|:.|.|::
  Fly   415 QANQVVGKV-NFNRMMTPFENMILP-----------------LLWVDLN----IDVLCLTLRLLI 457

  Fly   457 --------------ALWSVLKAIRVACGDL 472
                          ||..:|..:...|..|
  Fly   458 HGIKWGFPLLQWSAALGMLLAGVYQLCSAL 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 118/474 (25%)
CG10345NP_650563.2 CD36 21..488 CDD:279474 121/486 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49918933
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.