DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and Snmp2

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001163372.1 Gene:Snmp2 FlyBaseID:FBgn0035815 Length:556 Species:Drosophila melanogaster

Alignment Length:602 Identity:132/603 (22%)
Similarity:217/603 (36%) Gaps:180/603 (30%)


  Fly     4 VQWVKILLCLILACVNVFLFVVSWGVDYRILVAREHIRFRQEMPTMDS------WINSPFG-KLK 61
            :.|     .||::.:.|.:.|:.....:.:.....|.:..|.:...|.      ::|.|.. ..|
  Fly     2 IHW-----SLIVSALGVCVAVLGGYCGWILFPNMVHKKVEQSVVIQDGSEQFKRFVNLPQPLNFK 61

  Fly    62 NYVFNVTNAEEFRSGRDSRLKVKEIGPIVY----------------------------------- 91
            .|:|||||::..:.|  :...|:||||.||                                   
  Fly    62 VYIFNVTNSDRIQQG--AIPIVEEIGPYVYKQFRQKKVKHFSRDGSKISYVQNVHFDFDAVASAP 124

  Fly    92 -----RIVGFN------------DILD-----RNETNVRYRK-HRYRVVEFLPEESVAPDVLNWT 133
                 |||..|            :|.|     .|..|.|..: ...||::.|.|.          
  Fly   125 YTQDDRIVALNMHMNAFLQVFEREITDIFQGFANRLNSRLNQTPGVRVLKRLMER---------- 179

  Fly   134 ITSTNNVIL-------GAATKVKH-TAPLAAFGFDAALMMEDIFVTDSVYYFLWEFTRPLLQTLS 190
            |......:|       |.|..:.| .|.|.|...|...|    ||:.||..:|::..|..:    
  Fly   180 IRGKRKSVLQISENDPGLALLLVHLNANLKAVFNDPRSM----FVSTSVREYLFDGVRFCI---- 236

  Fly   191 RISNIRPNVAVLYNALKEK-------------------------EEVYTVNIG---PKRGIENFF 227
               |.:.....:.|.:||.                         .|||.|:.|   |.|.:|   
  Fly   237 ---NPQGIAKAICNQIKESGSKTIREKSDGSLAFSFFGHKNGSGHEVYEVHTGKGDPMRVLE--- 295

  Fly   228 RIETLNGEVIIREQLPHTRQYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQ 292
             |:.|:....::..|..:.:.:::.|  |.....|.|.:|||.|....:.|.:.:.||.:.|.||
  Fly   296 -IQKLDDSHNLQVWLNASSEGETSVC--NQINGTDASAYPPFRQRGDSMYIFSADICRSVQLFYQ 357

  Fly   293 RQERYNGLDTFRYTLLQS--------HQKPPGCLDTSYGV------KLPDGMFDVSQCVINDAPS 343
            ...:|.|:..:||::.::        |.....|:|....|      .|..|..|::.|:  |||.
  Fly   358 TDIQYQGIPGYRYSIGENFINDIGPEHDNECFCVDKLANVIKRKNGCLYAGALDLTTCL--DAPV 420

  Fly   344 AFSMPHFYGSSYNWSQHYEGYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLS 408
            ..::||..|:|..:.:...|..|:|:.|:.::.::.:||.|:....|.|.|:.:..:.|... ..
  Fly   421 ILTLPHMLGASNEYRKMIRGLKPDAKKHQTFVDVQSLTGTPLQGGKRVQFNMFLKSINRIGI-TE 484

  Fly   409 RFSNMMIPSFWYEFEMGQLPGFVTSLMWINVNIVQHIQPYCMVLFLVLALWSVLKAIRVACGDLG 473
            ....:::|:.|.| |..||.|.                   ||.|....|.:.||.:.       
  Fly   485 NLPTVLMPAIWVE-EGIQLNGE-------------------MVAFFKKKLINTLKTLN------- 522

  Fly   474 YVVLFRKLCGDLGTVTA 490
             :|.:..|||.:|...|
  Fly   523 -IVHWATLCGGIGVAVA 538

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 123/567 (22%)
Snmp2NP_001163372.1 CD36 12..541 CDD:279474 129/588 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52880151
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.