DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and scarb1

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_017213428.1 Gene:scarb1 ZFINID:ZDB-GENE-031126-1 Length:511 Species:Danio rerio

Alignment Length:481 Identity:114/482 (24%)
Similarity:216/482 (45%) Gaps:65/482 (13%)


  Fly    11 LCLILACVNVFLFVVSWGVDYRILVAREHIRFRQEMP-TMDSWINSPFGKLKNYVFNVTNAEEFR 74
            :.|:...|.||:..:.  :|.:| |....|..:.::. ||...|..|| .:..|.|::.|.:|..
Zfish    17 MALLFGTVLVFVGPII--IDDQI-VKNVEINPKNDLSYTMWKDIPVPF-FMSVYFFHIVNPDEIL 77

  Fly    75 SGRDSRLKVKEIGPIVYRIVGFNDILDRNETN-VRYRKHRYRVVEFLPEESVAPDVLNWTITSTN 138
            .|  .|..|.:.||.|||...:.|.:..:|.: |.|:::|    ::..|||::....:..:|..|
Zfish    78 KG--ERPMVIQRGPYVYRENRWKDNITFHENHTVSYKEYR----QYFFEESMSVGDESDVVTIPN 136

  Fly   139 NVILGAATKVKHTAPLAAFGFDAALMM--------EDIFVTDSVYYFLWEFTRPLLQTLSR-ISN 194
            .::|||:..:::      ..|...|::        |..|:|..|...:|.:...|:..|:: :..
Zfish   137 MLVLGASVMMEN------MPFPVRLLLSTTFKTFNEGPFLTKPVGELMWGYDSKLVDFLNKYLPG 195

  Fly   195 IRPN---VAVLYNALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLPHTRQYDSNSCPFN 256
            :.|:   ..:..:.......::|:..| :..|.....:::.||       |.:...:.|:.|  |
Zfish   196 MLPSSGKFGLFADFNNSNTGLFTIFTG-RDDIRKVHMVDSWNG-------LKNVDYWRSDQC--N 250

  Fly   257 VSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRY----TLLQSHQK-PPG 316
            :.......::|||:..:|.:...:.::||.:.|.|||....:|:..:||    ||..:... ||.
Zfish   251 MINGTAGQMWPPFMTKETTMPFYSPDACRSMELVYQRPLVSSGIPVYRYVSPKTLFANGADFPPN 315

  Fly   317 -----CLDTSYGVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYEGYTPNAEDHEPYIL 376
                 |..:        |:.:||.| .:.:|:..|.||||.:.........|.:|:.::|..:|.
Zfish   316 EGFCPCRQS--------GLLNVSSC-RHGSPTFISQPHFYNADPQLLDTVSGLSPSEDEHGLFID 371

  Fly   377 LEPVTGIPVTEKYRFQSNIPIPDLRRFS--SRLSRFSNMMIPSFWYEFEMGQLPGFVTSLMWINV 439
            :.|.||:||....|.|.|:   .|::.|  |.....:.:::|..|:| |.|.:.|.|......|:
Zfish   372 IHPETGVPVNVSVRLQLNL---FLKKVSGISETGNIAEVVMPMLWFE-ESGYIDGPVLHTFRTNL 432

  Fly   440 NIVQHIQPYCMVLFLVLALWSVLKAI 465
            .::..:..|...:|:.|.|.::|.|:
Zfish   433 VVLPKVMEYMQYIFIALGLAAILTAV 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 112/477 (23%)
scarb1XP_017213428.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50640326
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.629 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.