DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and emp

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_726504.2 Gene:emp FlyBaseID:FBgn0010435 Length:551 Species:Drosophila melanogaster

Alignment Length:515 Identity:127/516 (25%)
Similarity:218/516 (42%) Gaps:105/516 (20%)


  Fly     6 WVKILLC-------LILACVNVFLFVVSWGVDYRIL---VAREHIRFRQEMPTMDSWINSPF-GK 59
            |:.|::.       :::||            ::.:|   |....:..|....|...|...|. .:
  Fly    52 WITIVVAAALIIGGIVVAC------------EFTVLIDAVVDRMVALRPGAKTFGWWAKPPVEPR 104

  Fly    60 LKNYVFNVTNAEEFRSGRDSRLKVKEIGPIVY-----RIVGFNDILDRNETNVRYRKHRYRVVEF 119
            :..|::|||||::|.| ..|:..|.|:||.||     ::    :|::.:...:.|...  ::..|
  Fly   105 ISLYIYNVTNADDFLS-NGSKAIVDEVGPYVYSETWEKV----NIVENDNGTLSYNLR--KIYSF 162

  Fly   120 LPEESVAPDVLNWTITSTNNVILGAATKVKHTAPLAAFGFDAALMMEDI-----FVTDSVYYFLW 179
            ..:.||.|:  :..:...|..:|.|.::.||.|....... |::|  ||     ||..||...||
  Fly   163 REDLSVGPE--DDVVIVPNIPMLSATSQSKHAARFLRLAM-ASIM--DILKIKPFVQVSVGQLLW 222

  Fly   180 EFTRPLLQTLSRISNIRP--------NVAVLYNALKEKEEVYTVNIGPKRGIENFFRIETLNGEV 236
            .:..|||:.   ..::.|        ...:||.......:..|||.|.. .|..:..|:..||  
  Fly   223 GYEDPLLKL---AKDVVPKEQKLPYEEFGLLYGKNGTSSDRVTVNTGVD-DIRRYGIIDNFNG-- 281

  Fly   237 IIREQLPHTRQYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQ-ERYNGL 300
              |..|||   :.:::|  |.....|.|:|||.:..|..|.:...:.||:|||.:::: ...|.:
  Fly   282 --RTHLPH---WTTDAC--NTLAGTDGSIFPPHIDHDRILHVYDKDLCRLLPLVFEKEVMTSNEV 339

  Fly   301 DTFRYTL-------LQSHQK--------PPGCLDTSYGVKLPDGMFDVSQCVINDAPSAFSMPHF 350
            ..:|:|.       :.||..        .|.|        .|:|:|:||.|.. |:|...|.|||
  Fly   340 PGYRFTPPEWVFADVDSHPDNMCFCPAGKPSC--------SPNGLFNVSLCQY-DSPIMLSFPHF 395

  Fly   351 YGSSYNWSQHYEGYT-PNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIP---DLRRFSSRLSRFS 411
            |.:..:.....||.: |..|.|:.:..::|..|..:..:.|.|.|:.:.   |::    :::.|.
  Fly   396 YLADESLRTQVEGISPPMKEKHQFFFDVQPKMGTTLRVRARIQINLAVSQVFDIK----QVANFP 456

  Fly   412 NMMIPSFWYEFEMGQLPGFVTSLMWINVNIVQHIQPYCMVLFLV--LALWSVLKAIRVAC 469
            :::.|..|:|..:..||..||.||    ...:.:.|...|..:|  .||..:|..:...|
  Fly   457 DIIFPILWFEEGIDNLPDEVTDLM----RFAEQVPPKIRVALIVGLCALGVILLLLSTFC 512

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 123/503 (24%)
empNP_726504.2 CD36 58..511 CDD:279474 124/507 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49918856
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.