DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and CG7227

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001245934.1 Gene:CG7227 FlyBaseID:FBgn0031970 Length:518 Species:Drosophila melanogaster

Alignment Length:527 Identity:119/528 (23%)
Similarity:200/528 (38%) Gaps:135/528 (26%)


  Fly     6 WVKILLCLILACVNVF---------LFVVSWGVDYRILVAREHIRFRQEMPTMDSWINSPFGKLK 61
            |...:|.|:||..::|         .:::.|   :.:|.....|....:.|.||  ||     :.
  Fly     8 WQTSVLGLLLASFSLFSVLYMEQIERWMLEW---FMVLRPGTMISSLWQSPAMD--IN-----VD 62

  Fly    62 NYVFNVTNAEEFRSGRDSRLKVKEIGPIVYRIVGFNDIL--------DRNETNVRYRKHRYRVVE 118
            .|:||.||:|:| |....:.:.:|:||  ||   |.:.:        |.|.| |.||: |.| .:
  Fly    63 LYIFNWTNSEKF-SDPTVKPRFEELGP--YR---FTERMQKVNVEWHDENST-VSYRR-RSR-FD 118

  Fly   119 FLPEESVA----PDVLNWTITSTNNVILGAATKVKHTAPLAAFGFDAALMM--------EDIFVT 171
            |.|:.||.    |      |.:.|.:|:|...|:...:|:.     .:||:        |...:.
  Fly   119 FDPKLSVGRPTDP------IVAPNLLIVGLYQKMVMWSPML-----RSLMLLALNIYGKEQAMIR 172

  Fly   172 DSVYYFLWEFTRPLLQTLSRI-SNIRPNVAVLY---------NALKE---KEEVYTVNIGPKRGI 223
            .:..:....|..|:::....: .::.|.:...|         |...|   ...|||       |.
  Fly   173 PASDWMFDGFDTPMIKMSKMVPPSLVPEMKFPYEKIGYAYPRNGSMEIYGHHNVYT-------GR 230

  Fly   224 ENFFRIETLNGEVI------IREQLPHTRQYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIE 282
            :.|.::    |::.      :.|..|.        |....|....:.:  |.|: ..|:|....:
  Fly   231 DEFQKL----GQIARWRYNNVTEASPR--------CKLKGSAGEFHPI--PLVK-GRPISYFLPD 280

  Fly   283 SCRVLPLTYQRQERYNGLDTFRY-----TLLQSHQKPPG---CLDTSYGVKLPDGMFDVSQCVIN 339
            .||.|.:.|.....:.|:|.|.|     .:......|..   |.|....|:  .|:.::|.|...
  Fly   281 LCRELQVDYSGTTIFEGIDAFVYRGSARNMANGTDNPDNSCYCQDNCQEVR--SGLLNISSCWYG 343

  Fly   340 DAPSAFSMPHFYGSSYNWSQHYEGYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFS 404
             .|...|.|||:.:...:.:..||..|:.:.||..|:|||.||:.:..|.|..:|:.:.......
  Fly   344 -TPVFASYPHFFKADPYYGEQVEGMKPDKDRHEMVIMLEPKTGMVLEIKARIMANLLVEPKTHLI 407

  Fly   405 SRLSRFSNMMIPSFWYEFEMGQLPGFVTSLMWINVNIVQHIQPYCMVLFLVLALWSVLKAIRVAC 469
            .|.:|  ....|..|.::               ||.|...:..|       :.|..:|:.:...|
  Fly   408 YRTAR--RTFFPLIWADY---------------NVRITDDLLVY-------VKLMPILEFVGKIC 448

  Fly   470 GDLGYVV 476
            |.||.|:
  Fly   449 GILGVVL 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 112/508 (22%)
CG7227NP_001245934.1 CD36 13..463 CDD:279474 118/523 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50690344
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.