DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and pes

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001137808.1 Gene:pes FlyBaseID:FBgn0031969 Length:555 Species:Drosophila melanogaster

Alignment Length:492 Identity:106/493 (22%)
Similarity:203/493 (41%) Gaps:79/493 (16%)


  Fly    10 LLCLILACV--NVFLFVVSWGVDYRILVAREHIRFRQEMPTMDSWINSPFG-KLKNYVFNVTNAE 71
            ::.|.:.|:  .::|| .:| :|....:..:.:.......:.:.|..||.. ....|:||.||.:
  Fly    13 IVLLGICCIASGIYLF-RNW-IDMFTRMRGQEMALSPNSRSFEGWKVSPLPLDFDIYLFNWTNPD 75

  Fly    72 EFRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETNVRYRKHRYRVVEFLPEESVAPDVLNW---- 132
            :|..|.:.:...:::||  ||   |.:..|:  .::.:..|         ..||:....:|    
  Fly    76 DFYVGSNKKPHFEQLGP--YR---FREKPDK--VDIEWHNH---------NASVSFHKKSWFYFD 124

  Fly   133 ----------TITSTNNVILGAATKVKHTAPLAAFGFDAA--LMMEDIFVTDSVYYFLWE-FTRP 184
                      .:|:.|:|...||.:.. ....|..|.:.|  |..:.:.:|.:|...|:: :..|
  Fly   125 AAGSNGSLWDKVTTVNSVAHSAARRAA-VDWFARTGVNIANKLYRQGVTITKTVDEMLFKGYEHP 188

  Fly   185 LLQT--LSRISNIRPNVAVLYNALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLPHTRQ 247
            .:..  |.|..:: |...:.|:..:.....:..:|....|.::..::    |::.....|.||..
  Fly   189 FISVGKLLRPQDV-PYKRIGYHYPRNGSSEFDGDINMFTGADDIAKM----GQIHTWNNLTHTGA 248

  Fly   248 YDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRYTLLQSHQ 312
            :: .:|. .|.|:: ...|||.:.....:.:...:.||.:||.|......:|:..::::..: |.
  Fly   249 FE-GTCG-QVHGSM-GEFFPPNLGTKDTVYMYMPKMCRAIPLDYVETVTVHGVTAYKFSGTR-HA 309

  Fly   313 KPPGCL--DTSY----GVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYEGYTPNAEDH 371
            ...|.|  ||..    |..:|.|:.::..|..| |....|.||||.:..::.:..||..|..|.|
  Fly   310 VDNGTLYPDTRCYCVGGKCMPSGVINIGPCSFN-ASVYMSFPHFYMADPSYLEAIEGLRPEREKH 373

  Fly   372 EPYILLEPVTGIPVTEKYRFQSNI---PIPDLRRFSSRLSRFSNMMIPSFWYEFEMGQLPGFVTS 433
            |.::.|||..|:|:.....||:|.   |||.:..:.:    ...:|||..|.|            
  Fly   374 EFFMALEPNAGVPMDVGGGFQANYYMEPIPGITLYEN----VPTVMIPMMWCE------------ 422

  Fly   434 LMWINVNIVQHIQPYCMVLFLVLALWSVLKAIRVACG 470
               ..|.:.:.|.....::.|::.|..::..|.:|.|
  Fly   423 ---ERVRVSEEIAADIALVPLIVLLGQIVTGILLAGG 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 103/483 (21%)
pesNP_001137808.1 CD36 14..463 CDD:279474 106/492 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50690446
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.