DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and scarb2c

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001352071.1 Gene:scarb2c ZFINID:ZDB-GENE-030131-5789 Length:478 Species:Danio rerio

Alignment Length:499 Identity:111/500 (22%)
Similarity:187/500 (37%) Gaps:107/500 (21%)


  Fly    11 LCLILACVNVFLFVVSWGVDYRIL------VAREHIRFRQEMPTMDSWINSPFG-KLKNYVFNVT 68
            ||::|....:.|.:.      |:|      ..::.|...........|.|.|.. .::.|.||:|
Zfish    14 LCVLLLICGIALELT------RVLQKLVNNTVKQQIVLENGTEAFSVWQNPPPPVYMQFYFFNLT 72

  Fly    69 NAEEFRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETNVRYRKHRYRVVEFLPEESVAPDVLNWT 133
            |..|..||  .:..|.:|||..||..       |....|::..:..||....|:          |
Zfish    73 NPAEVMSG--DKPSVVQIGPYTYREY-------RPMEEVKFMDNGTRVAAINPK----------T 118

  Fly   134 ITSTNNVILGAATKVKHTAPLAAFGF-----DAAL--MMED--------IFVTDSVYYFLWEFTR 183
            .....|:..|:...:..|..:.|...     |:.|  ::.|        :|.|..|...||.:..
Zfish   119 YVFEPNMSRGSQDDLVRTVNIPAVTVMEKYKDSILARLISDLMKAKGVGVFETFRVGDLLWGYED 183

  Fly   184 PLLQTLSRISNIRP--NVAVLYNALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLPHTR 246
            |||:.|..:.   |  :..:.|.....:.:.|.:..| |...::|..|:..||:..:       .
Zfish   184 PLLKELHMLV---PDDHFGLFYKKNGTEYDSYVLLTG-KPDYQDFASIDEWNGQRSL-------N 237

  Fly   247 QYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRYTLLQSH 311
            .:.|..|  |:....|.:.|.|.:.....|.|.:.:.||.|.:.|:......|:..||:.     
Zfish   238 WWSSEEC--NMINGTDGASFHPIITKADRLYIFSSDLCRSLYVQYECDVSVQGVPGFRFV----- 295

  Fly   312 QKPPGCLDTSYGVKLPD--------------GMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYE 362
              ||..:.:|..:. ||              |:.:.|.|. ..||...|.||||.:...:.....
Zfish   296 --PPADVFSSPDIN-PDNAGFCVPPGHCLGSGLLNASVCK-QGAPIIMSSPHFYQADQKFVDDIW 356

  Fly   363 GYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIP-------SFWY 420
            |..|..|:|:.:..:.|:|||.:....|.|.|:.:.....| |:..:...::.|       :|..
Zfish   357 GMKPIKEEHQTFADINPLTGIVLQGAKRVQVNVYLQQHSSF-SQTGKIQTLVFPVMYINESAFID 420

  Fly   421 EFEMGQLPGFVTSLMWINVNIVQHIQPYCM--------VLFLVL 456
            |....:|...|     :|.|:|.:| |:.:        ::|:||
Zfish   421 EESAKKLHAVV-----LNANVVINI-PFIVISVGILLGIIFIVL 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 111/500 (22%)
scarb2cNP_001352071.1 CD36 15..457 CDD:307331 108/496 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.