DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and CG40006

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001036401.1 Gene:CG40006 FlyBaseID:FBgn0058006 Length:689 Species:Drosophila melanogaster

Alignment Length:474 Identity:110/475 (23%)
Similarity:191/475 (40%) Gaps:111/475 (23%)


  Fly    52 WINSPFG-KLKNYVFNVTNAEEFRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETNVRYRKHRYR 115
            |...|.. .:|.|:||:|||..|.:||: :|:|:::||.||:.:..::.:..|..|.......:.
  Fly   134 WAQPPVDLYIKIYLFNITNANAFLAGRE-QLRVEQVGPYVYKEIMTHENVTFNSNNTMSSTPSHP 197

  Fly   116 VVEFLPEESVAPD--------VLNWT------ITSTNNVILGAATK-----------VKHTAPLA 155
            :|.   :|.::.:        :||..      :|:....::..|.|           |:.||...
  Fly   198 LVW---QEEMSGNCREDDEVVMLNIAMLAISHLTANQPFLVRMALKTLLLSTKSEPIVRTTAKEF 259

  Fly   156 AFGFDAAL------------MMEDIFVTDSVYYFLWEFTRPLLQTLSRISNIRPNVAVLYNALKE 208
            .||:.:||            ..|.:.:.|.:|.|..:|                           
  Fly   260 MFGYPSALATLGNTFLPNWISFEKVGLIDRMYDFSTDF--------------------------- 297

  Fly   209 KEEVYTVNIGPK-RGIENFFRIETLNGEVIIREQLPHTRQYDSNSCPFNVSGALDNSLFPPFVQP 272
             |..||....|. .|:...:|.||         .||   |:|.:.|. |:..|.|.:.|..|:||
  Fly   298 -ETFYTGVPNPALSGLYASYRGET---------TLP---QWDGDHCS-NIEFASDGTKFKSFIQP 348

  Fly   273 DTPLSIVAIESCRVLPLTYQR---QERYNGLDTFRYTLLQSHQKPPGCLDTS------YGVKLPD 328
            :..:.......||  |:...|   ::.|..|..:.| :.:.:....|..:.:      .|...|.
  Fly   349 NETVKFFRKSMCR--PINLYRVGNEKTYGSLKGYNY-VFEDNAFDNGATNEANKCFCRKGDCQPV 410

  Fly   329 GMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYEGYTPNAEDHEPYILLEPVTGIPVTEKYRFQS 393
            |:.||:.|... .|.:.|.|||........|:..|.:|:.:.|....:::|.:|:|::...:.|.
  Fly   411 GLIDVTDCYYG-FPISLSFPHFMNGDVGLQQNVTGISPDPDKHSSTFVIQPESGLPLSLSVKVQI 474

  Fly   394 NIPIPDLRRFSSRLSRFSNMMIPSFWYEFEMGQLPGFVTSLMWINVNIVQHIQPYCMVLFLVLAL 458
            |:...||..|.. :|.|:::.:|..|:|..|.:||..:.|.....:||:..:.|        |..
  Fly   475 NMHFKDLSNFPV-VSVFNHLTVPMLWFEIMMSKLPDSLDSRFNFYLNILPLVNP--------LGF 530

  Fly   459 WS-VLKAIRVACGDLGYVV 476
            || :|..|.:    |||.:
  Fly   531 WSGILLGISL----LGYAI 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 105/459 (23%)
CG40006NP_001036401.1 CD36 91..545 CDD:279474 110/473 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49918971
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.