DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and crq

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001245823.1 Gene:crq FlyBaseID:FBgn0015924 Length:491 Species:Drosophila melanogaster

Alignment Length:483 Identity:102/484 (21%)
Similarity:188/484 (39%) Gaps:100/484 (21%)


  Fly    22 LFVVSW-GVDYRILVAREHIRFRQEMPTMDSWINSPFG-KLKNYVFNVTNAEEFRSGRDSRLKVK 84
            |.||.| |:...::  .:.:..:......:||:.:|.. .|..|:||.||.|:.|: .|.:....
  Fly    28 LIVVFWPGIADNLV--EDGLTLKPGTDAYESWLEAPIPIYLSFYMFNWTNPEDIRN-PDIKPNFV 89

  Fly    85 EIGPIVYRIVGFNDILDRNETNVRYRKHRYRVVEFLPEESVA----------PDVLNWT----IT 135
            |:||..:                 ..||:.....|....:||          |:..|.|    :|
  Fly    90 EMGPYTF-----------------LEKHKKENYTFYDNATVAYYERRTWFFDPERSNGTLDDMVT 137

  Fly   136 STNNVILGAATKVKHTAPLAAFGFDAALMME--DIFVTDSVYYFLWEFTRPLLQTLSRISNIRP- 197
            :.:.:....|.:::....:.....:..|..|  .::||..|..:::|..:..:.....:.|... 
  Fly   138 AAHAITATVADEMRDQRKIVKKIINFMLNHEGGKLYVTKPVGEWIFEGYQDNITDFLNLFNTTKI 202

  Fly   198 -------------NVAVLYNALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLPHTRQYD 249
                         |.::.|:.|      :|::.|.. .|.|..|:...||:       ..|..|:
  Fly   203 DIPYKRFGWLADRNESLTYDGL------FTIHTGTD-DISNLGRLTHWNGK-------SETGFYE 253

  Fly   250 SNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPL----TYQRQERYNGLDTFRYT---- 306
               .|..:.......:|||.:..:..::|.|.::||.:.|    ||:.    :||...::.    
  Fly   254 ---MPCGIVNGTTGDMFPPKMNVNDEITIFATDACRFMNLRPRGTYEN----HGLTATKWVGTEE 311

  Fly   307 LLQSHQKPPG----CLDTSYGVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYEGYTPN 367
            .|.|.:..|.    |.:..:......|:.:...| .:.||...|.||||.:..::.....|..|.
  Fly   312 TLDSGENYPNQACFCDEARFDECPKTGVVECKAC-RDKAPIYSSFPHFYLADQSYVDAVSGMKPE 375

  Fly   368 AEDHEPYILLEPVTGIPVTEKYRFQSNIPIP-----DLRRFSSRLSRFSNMMIPSFWYEFEMGQL 427
            .|.||.::.:||:||:||....|.|.|:.|.     |:.|      ....:::|.||:: :..:|
  Fly   376 KEKHEFFLAVEPITGVPVQVHGRIQINMMIEPDDDFDIYR------GVQKVLMPMFWFD-QYAEL 433

  Fly   428 PGFVTSLMWINVNIVQH--IQPYCMVLF 453
            ...:.|...:.:|:..:  |..|.|:.|
  Fly   434 SSELASKAKLAINLSSYGIIFGYSMIAF 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 102/484 (21%)
crqNP_001245823.1 CD36 19..470 CDD:307331 102/484 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50690389
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.