DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and ninaD

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_724087.1 Gene:ninaD FlyBaseID:FBgn0002939 Length:513 Species:Drosophila melanogaster

Alignment Length:433 Identity:99/434 (23%)
Similarity:173/434 (40%) Gaps:96/434 (22%)


  Fly    18 VNVFLFVVSWG--VDYRILVAREHIRFRQEMPTMDSWINSPFG-KLKNYVFNVTNAEEFRSGRDS 79
            |:..|.::.|.  :|..|:.|   :.......|.:.|...|.. .:..|::|.|||.:.::.   
  Fly    24 VSGLLAIICWPGFIDSGIMKA---LPLTPTSKTFEKWEELPIPVYVYMYLWNWTNAADVQAN--- 82

  Fly    80 RLKVK----EIGPIVYRIVGFNDILDRNETNVRYRKHRYRVVEFLP------EESVAPDVLNWTI 134
              .||    ::||.|||       .:|.:.::.:  |....|.|.|      ||.::.......|
  Fly    83 --GVKPIFAQLGPYVYR-------EERKKMDLEW--HDNGTVTFNPRRTWFWEEELSGGKQTDLI 136

  Fly   135 TSTNNVILGAATKVKHTAPLAAFGFDAALMME--DIFVTDSVYYFLWE-FTRPLLQTLSRISN-I 195
            |:.:...|.|:.:::::.....|.|:.||...  .:|||.:...:|:| |....|.....::| :
  Fly   137 TAPHLPSLAASNQMRNSNVFLKFMFNEALNANGGHLFVTHTAAEWLFESFYDEFLHYAMTLNNPL 201

  Fly   196 RPNVA-------VLYNALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLPHTRQYDSNSC 253
            .|.:.       :..|..|:.|..:||:.| ...|:....|:...|:       .||..|| ..|
  Fly   202 VPKIESDHFAWFLNRNGSKDFEGPFTVHTG-VGDIKEMGEIKYWKGQ-------NHTGWYD-GEC 257

  Fly   254 PFNVSGALDNSLFPPFVQPDTP----LSIVAIESCRVLPLTYQRQ-ERYNGLDTFRYTLLQS--- 310
                 |.|:.|....|| ||.|    |:|...::||::.|.:..| |...|:..::|.:..:   
  Fly   258 -----GRLNGSTTDLFV-PDEPKEKALTIFIPDTCRIINLEFTGQSETIQGITGWKYEITPNTFD 316

  Fly   311 --------------HQKPPGCLDTSYGVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHY 361
                          .::|..|..|        |..|:..|. :..|...|..||..:..::....
  Fly   317 NGQINGNAKCWCPLERQPDNCPAT--------GATDLGPCA-DGVPMYLSADHFMYADESYGSTI 372

  Fly   362 EGYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPI-----PD 399
            .||.||.:.:..||::|...|:|:    :..:|:.|     ||
  Fly   373 SGYNPNYDQNNFYIIMERKMGVPL----KVNANVMITLYIEPD 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 99/434 (23%)
ninaDNP_724087.1 CD36 19..474 CDD:279474 99/434 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50690496
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.