DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and Scarb1

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_113729.1 Gene:Scarb1 RGDID:2302 Length:509 Species:Rattus norvegicus

Alignment Length:503 Identity:121/504 (24%)
Similarity:213/504 (42%) Gaps:90/504 (18%)


  Fly     5 QWVKI------LLCLILACVNVFLFVVSWGVDYRILVAREHIRFRQEMPTMDSW--INSPFGKLK 61
            :||.:      |||..|..: :.|.|.|. :..::|   :::|......:...|  |..|| .|.
  Rat     8 RWVALGLGVLGLLCAALGVI-MILMVPSL-IKQQVL---KNVRIDPSSLSFGMWKEIPVPF-YLS 66

  Fly    62 NYVFNVTNAEEFRSGRDSRLKVKEIGPIVYR------IVGFNDILDRNETNVRYRKHRYRVVEFL 120
            .|.|.|.|..|..:|:  :..|:|.||.|||      .:.|||    |:| |.|.::  |.:.|.
  Rat    67 VYFFEVVNPSEVLNGQ--KPVVRERGPYVYREFRQKVNITFND----NDT-VSYIEN--RSLRFQ 122

  Fly   121 PEES--------VAPDVLNWTITSTNNVILGAATKV--KHTAPLAAFGFDAALMMEDIFVTDSVY 175
            |:.|        |.|::|          :||.|..:  |.|:...........|.:..|:..:|.
  Rat   123 PDRSQGSESDYIVLPNIL----------VLGGAVMMEDKPTSLKLLMTLGLVTMGQRAFMNRTVG 177

  Fly   176 YFLWEFTRPLLQTLSR----ISNIRPNVAVLYNALKEKEEVYTVNIGPKRGIENFFRIETL---N 233
            ..||.:..|.:..||:    :..|:....:..........|:||    ..|::||.:|..:   |
  Rat   178 EILWGYEDPFVNFLSKYFPDMFPIKGKFGLFVGMNDSSSGVFTV----FTGVQNFSKIHLVDKWN 238

  Fly   234 GEVIIREQLPHTRQYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYN 298
            |       |.....:.|..|  |:.......::.||:.|::.|...:.|:||.:.||||....:.
  Rat   239 G-------LSEVNYWHSEQC--NMINGTAGQMWAPFMTPESSLEFFSPEACRSMKLTYQESRVFE 294

  Fly   299 GLDTFRYTLLQSHQKPPGCLDTSYGVKLPD---------GMFDVSQCVINDAPSAFSMPHFYGSS 354
            |:.|:|:|       .|..|..:..|..|:         |:.:||.|... ||...|.||||.:.
  Rat   295 GIPTYRFT-------APDTLFANGSVYPPNEGFCPCRESGIQNVSTCRFG-APLFLSQPHFYNAD 351

  Fly   355 YNWSQHYEGYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIPSFW 419
            ...|:...|..|:.::|..::.:.||||||:....:.|.::.|..::.. .:..:...:::|..|
  Rat   352 PVLSEAVLGLNPDPKEHSLFLDIHPVTGIPMNCSVKMQLSLYIKSVKGV-GQTGKIEPVVLPLLW 415

  Fly   420 YEFEMGQLPGFVTSLMWINVNIVQHIQPYCMVLFLVLALWSVLKAIRV 467
            :| :.|.:.|...:..:..:.::..:..|..  :::|.|..:|..:.:
  Rat   416 FE-QSGMMGGKTLNTFYTQLVLMPQVLHYAQ--YVLLGLGGLLLLVPI 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 118/486 (24%)
Scarb1NP_113729.1 CD36 21..447 CDD:279474 114/476 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50654332
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.632 Consistency score
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.