DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and Scarb1

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001192012.1 Gene:Scarb1 MGIID:893578 Length:520 Species:Mus musculus

Alignment Length:510 Identity:120/511 (23%)
Similarity:213/511 (42%) Gaps:100/511 (20%)


  Fly     5 QWVKI---LLCLILACVN-VFLFVVSWGVDYRILVAREHIRFRQEMPTMDSW--INSPFGKLKNY 63
            :||.:   .|.|:.|.:. |.:.:|...:..::|   :::|......:...|  |..|| .|..|
Mouse     8 RWVALGLGALGLLFAALGVVMILMVPSLIKQQVL---KNVRIDPSSLSFGMWKEIPVPF-YLSVY 68

  Fly    64 VFNVTNAEEFRSGRDSRLKVKEIGPIVYR------IVGFNDILDRNETNVRYRKHRYRVVEFLPE 122
            .|.|.|..|..:|:  :..|:|.||.|||      .:.|||    |:| |.:.::  |.:.|.|:
Mouse    69 FFEVVNPNEVLNGQ--KPVVRERGPYVYREFRQKVNITFND----NDT-VSFVEN--RSLHFQPD 124

  Fly   123 ES--------VAPDVLNWTITSTNNVILG---------AATKVKHTAPLAAFGFDAALMMEDIFV 170
            :|        |.|::|          :||         .:.|:..|..|...|       :..|:
Mouse   125 KSHGSESDYIVLPNIL----------VLGGSILMESKPVSLKLMMTLALVTMG-------QRAFM 172

  Fly   171 TDSVYYFLWEFTRPLLQTLSR----ISNIRPNVAVLYNALKEKEEVYTVNIGPKRGIENFFRIET 231
            ..:|...||.:..|.:..|:.    :..|:....:..........|:||    ..|::||.||..
Mouse   173 NRTVGEILWGYDDPFVHFLNTYLPDMLPIKGKFGLFVGMNNSNSGVFTV----FTGVQNFSRIHL 233

  Fly   232 L---NGEVIIREQLPHTRQYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQR 293
            :   ||       |.....:.|..|  |:.......::.||:.|::.|...:.|:||.:.|||..
Mouse   234 VDKWNG-------LSKIDYWHSEQC--NMINGTSGQMWAPFMTPESSLEFFSPEACRSMKLTYNE 289

  Fly   294 QERYNGLDTFRYTLLQSHQKPPGCLDTSYGVKLPD---------GMFDVSQCVINDAPSAFSMPH 349
            ...:.|:.|:|:|       .|..|..:..|..|:         |:.:||.|... ||...|.||
Mouse   290 SRVFEGIPTYRFT-------APDTLFANGSVYPPNEGFCPCRESGIQNVSTCRFG-APLFLSHPH 346

  Fly   350 FYGSSYNWSQHYEGYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMM 414
            ||.:....|:...|..||.::|..::.:.||||||:....:.|.::.|..::.. .:..:...::
Mouse   347 FYNADPVLSEAVLGLNPNPKEHSLFLDIHPVTGIPMNCSVKMQLSLYIKSVKGI-GQTGKIEPVV 410

  Fly   415 IPSFWYEFEMGQLPGFVTSLMWINVNIVQHIQPYCMVLFLVLALWSVLKAIRVAC 469
            :|..|:| :.|.:.|...|..:..:.::..:..|..  :::|.|..:|..:.:.|
Mouse   411 LPLLWFE-QSGAMGGKPLSTFYTQLVLMPQVLHYAQ--YVLLGLGGLLLLVPIIC 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 116/494 (23%)
Scarb1NP_001192012.1 CD36 26..447 CDD:279474 111/476 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50674457
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.629 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.