DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and scarb2a

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_775366.1 Gene:scarb2a ZFINID:ZDB-GENE-020419-29 Length:531 Species:Danio rerio

Alignment Length:501 Identity:131/502 (26%)
Similarity:209/502 (42%) Gaps:80/502 (16%)


  Fly     9 ILLCLILACVNVFLFVVSWGVDYRILVAREHIRFRQEMPTMDSWINSPFGKLKNY-VFNVTNAEE 72
            ::|.:.|....||..::...:...|.:| |:.|      .:|.|||.|......| .|||||.:|
Zfish    19 LILGIALLLAQVFQTMIQERIKKEITLA-ENSR------VLDGWINPPPPVYMQYFFFNVTNPDE 76

  Fly    73 FRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETNVRYRKHRYRVVEFLPEESV--------APDV 129
            |.:|:: :.||.::||..||..       |...||.|.::..::....|:..|        .|:|
Zfish    77 FLAGKE-KAKVTQMGPYTYREY-------RPRENVTYLENGTKIFATNPKSFVFLRNMSAGDPEV 133

  Fly   130 LNWTITSTNNVILGAATKVK------HTAPLAAFGFDAALMMEDIFVTDSVYYFLWEFTRPLLQT 188
            ..  :|:.|..::....::.      .||.....|    .|...:|:..:|:..||.|..||   
Zfish   134 DR--VTTVNIPMIAVMNELNSYSFFVRTAVSMYMG----SMGMGLFMNRTVHEILWGFKDPL--- 189

  Fly   189 LSRISNIRPNV----AVLYNALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLPHTRQYD 249
            |:::..:||.|    .::||.....|..:..:.|.|..: |:.:|:|.||       :.....:.
Zfish   190 LTKLHAMRPEVDEHFGLMYNKNGTHEGEFVFHTGEKNYM-NYGKIDTWNG-------ISQMNWWS 246

  Fly   250 SNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRYTLLQSHQKP 314
            ||..  |:....|.|:|..|:.....|.|.|.:.||.:.|.|.|.....|:..||:........|
Zfish   247 SNQS--NMINGTDGSVFHTFLSRKELLYIFAADLCRSIHLGYVRDMEVKGIPAFRFAPPSDVLAP 309

  Fly   315 PGCLDTSYGVKLP------DGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYEGYTPNAEDHEP 373
            |.....:.|..:|      .|:..||.| ...||...|.||||.:...:....||..||.|:||.
Zfish   310 PDENPANAGFCVPAGDCLGKGVLKVSVC-RQGAPIVVSFPHFYQADERYINAIEGMNPNEEEHET 373

  Fly   374 YILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIPSFWYEFEMGQLPGFVTSLMWIN 438
            |:.:.|.||:|:....|.|.||.:..:|.|.:  ::|.|..|           .|     :|::|
Zfish   374 YLDINPTTGVPIRACKRAQLNIILKRVRGFPN--TKFLNETI-----------FP-----IMYVN 420

  Fly   439 --VNIVQHIQPYCMVLFLVLALWSVLKAIRVACGDLGYVVLFRKLC 482
              ..|.........:|.|::.:.|....|.:|.|.:..|||...:|
Zfish   421 ETATIDDESAAQMRMLLLIVTVVSNFPVIILALGVILLVVLIFLVC 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 124/479 (26%)
scarb2aNP_775366.1 CD36 30..463 CDD:279474 128/486 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.