DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and scav-6

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_492081.1 Gene:scav-6 WormBaseID:WBGene00008542 Length:590 Species:Caenorhabditis elegans

Alignment Length:622 Identity:124/623 (20%)
Similarity:209/623 (34%) Gaps:198/623 (32%)


  Fly    13 LILACVNVFLFVVSWGV---DYRILVARE------------HIRFRQEMPTMDSWINSPFGKLKN 62
            :::|.|.:...:|:|..   .|..||.:.            :..|:...|.:|:       .:|.
 Worm    15 VVIAIVFIVFGIVTWAAFSSIYSTLVIKNLQLTENSDTSLGYSAFQYTSPQVDN-------IMKF 72

  Fly    63 YVFNVTNAEEFRSGRDSRLKVKEIGPIVY------RIVGFNDILDRNETNVRYRKHRYRVVEFLP 121
            |.|||||.:|.:. ..:...:.||||...      :.:.|:|    :::.:.|:.::    :::.
 Worm    73 YFFNVTNPDEVKY-YSAAPNLVEIGPFSVMESEQKKYLEFSD----DKSQMFYQNYK----KYIL 128

  Fly   122 EESVAPDVLNW-----------------------TITSTNNVILGAATKVKHTAPLAAF------ 157
            .:..:.:..:|                       .||.|...|:..|..:....|..:.      
 Worm   129 SKDYSCEDCDWDRNIVFPNPPGLGAVASMLDPQFQITKTGRTIIAVALTILGEYPFVSHKVREVL 193

  Fly   158 --GFDAALM--MEDIFVTDSVYYFLWEFTRPLLQTLSRISN------------IRPNVAVLYNAL 206
              |::.||:  ....|||                .||.|..            ..|.........
 Worm   194 FDGYEDALLSAAHSGFVT----------------VLSGIFKGDGGSIVPIPIPAMPKFGYFQGYN 242

  Fly   207 KEKEEVYTVNIGPK-----RGIENFFRIETLNGEVIIREQLPHTRQYDSNSCPFNVSGALDNS-- 264
            ..::|.|.:..|.|     ..::.:..|..|.||.....:....|..||.|.   ....||.|  
 Worm   243 NSRDEEYWIETGKKDINQIGNVQRWAGITELPGEWWTTPKARSIRGSDSGSF---TQMHLDESST 304

  Fly   265 --LFPPFVQPDTPLSIVAIESCRVLPLTYQRQER------------YNGLDT-------FRYTLL 308
              :|..|:             ||....|:.::|.            |:..||       |||..:
 Worm   305 ADMFFSFM-------------CRSFTKTFYQRETIESIPTIGYHIGYDEWDTTSDNNVGFRYRNI 356

  Fly   309 ----------------QSHQKPPGCLDTSYGVK----------------LPDGMFDVSQCV---I 338
                            |.||.  |.:|.|..:.                ||.|||.: .|.   :
 Worm   357 EKRNYFPDWPKCPPKGQCHQS--GSIDCSKSINFCHACCDGSLYNGTYLLPPGMFPL-VCYPGRL 418

  Fly   339 NDAPSA--FSMPHFYGSSYNWSQHYEGYTPNAEDHEPYILL-EPVTGIPVTEKYRFQSNIPIPDL 400
            ...|.|  :|.|||..|.........|..||...|||.|.. ||.:|..:....|.|.|:|:  :
 Worm   419 QPTPFAVVYSPPHFLFSPDEVRTTVVGMAPNKSLHEPMIYYHEPYSGTTLKVVNRLQVNMPV--I 481

  Fly   401 RRFSSRLSR-FSNMMIPSFWYEFEMGQLPGFVTSLMWINVNIVQHIQPYCMVLFLVLALWSVLKA 464
            |......|: ..|:|||.||.: ...:...|:.:.:|:...:|..:..  ::.|:.|.:..:|.|
 Worm   482 RSHDVPSSQNMPNVMIPLFWQD-TSPKYHQFIFNEVWLGFVLVPRLMR--VLQFVALGIGLLLVA 543

  Fly   465 IRVACGDLGYVVLFRKLCGDLGTVTALETKFQATSAS 501
            |         :|..:...|....:..|:|.|..|:::
 Worm   544 I---------IVFLQLRKGKPSLIRPLKTSFLETTSN 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 115/582 (20%)
scav-6NP_492081.1 CD36 18..547 CDD:279474 119/594 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.