DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and scav-4

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_510157.2 Gene:scav-4 WormBaseID:WBGene00008692 Length:560 Species:Caenorhabditis elegans

Alignment Length:564 Identity:117/565 (21%)
Similarity:205/565 (36%) Gaps:144/565 (25%)


  Fly     7 VKILLCLILACVNVFLFVVSWGVDYRI--------LVAREHIRFRQ----EMPT-MDSWINSPFG 58
            :::.:.:|||.  |.|.|.:.|:...|        .:....:..:|    ::|| ...|...|..
 Worm     1 MRLFVAIILAA--VILLVFALGIFLLIPFPIAIFQSIVDSQVYLQQKSDGQLPTGTFYWSKIPAV 63

  Fly    59 KLKNY-VFNVTNAEE--FRSGRDSRLKVKEIGPIVYRIVGFNDILD--RNETNVRYRKHRYRVVE 118
            ::..: :|||||.:|  :.....:.|   ||||..|....|.|...  .|:..:.|..::..|.:
 Worm    64 QIWTFHLFNVTNPDEVLYYGATPNML---EIGPYTYTETEFKDFTQFRDNDNEIFYVNNKTWVYD 125

  Fly   119 FLPEESVAPDVLNWTITSTNNVILGAATK--VKHTAPLAAFGFD--AALMMEDIFVTDSVYYFLW 179
              |..|.....|:.::...|...:.....  .:...|:..||.|  ..|:.|....|.:....|:
 Worm   126 --PTRSCEDCKLSDSVQFANTAYMSTVFMQIYQPAGPIVGFGLDVLTILLGEQPLRTVTAGGTLF 188

  Fly   180 E-FTRPLLQTLSRISNIRPNVAVLYNALKEKEEV-------------------YTVNIGPKRGIE 224
            : :..||:..::     .|.|.||.:.|....::                   ||:..| |...:
 Worm   189 DGYNDPLITLIN-----SPLVKVLLSVLGNPVQLPQVPAAGFFPHYSHTCDGNYTIRTG-KDNTD 247

  Fly   225 NFFRIETLNGEVIIREQLPHTRQYDSNSCPFNVSGALDNSLFPPFVQ-PDTPLSIVAIES--CRV 286
            ...:|:|.||    ...||..:..|::    ::.|..|.::..|.:| .||   :|..:|  ||.
 Worm   248 YVGQIKTWNG----LTHLPWWKTEDTS----DLRGTCDGTIQKPGIQKTDT---VVQFQSFLCRK 301

  Fly   287 LPLTYQRQERYNGLDTFRYTLLQSHQ---KPPG-------------------------------- 316
            ..|.|...:..|.:.|:.:.:.....   |.||                                
 Worm   302 YNLHYHESKTVNSIPTYGFKVEDDSYDAIKNPGYRYENFEKVNYFPNWPCGLNHTKQNNGNCALV 366

  Fly   317 -----------CLDTSY---GVKLPDGMFDVSQCVIND-APSAF----SMPHFYGSSYNWSQHYE 362
                       |.|.|:   ...:|.||.. .:|:... .|:.|    |.|||||:....::...
 Worm   367 DCNQYDNFCNACCDGSHVNGTYVMPPGMVP-QRCLPGQMVPTPFGAILSAPHFYGAPKVVTESMV 430

  Fly   363 GYTPNAEDHEP---YILLEPVTGIPVTEKYRFQSNIPIPDLRRFSS----RLSRFSNMMIPSFWY 420
            |..|:.|.|.|   ||  .|.||..:..::|...:||:     |.|    .:|...|.::|||..
 Worm   431 GIHPDPELHRPGTFYI--NPATGSTIGGEFRMMLSIPV-----FQSLAWTLMSNAPNAIMPSFTL 488

  Fly   421 EFEMGQLPGFVTSLMWINVNIVQHIQ-----PYCMVLFLVLALW 459
            ...: .:..:..:.::.|...:.:|.     .:..|..:.:.||
 Worm   489 TIGV-VMKDYAVNYIYFNTVTIPNIVLGLGIGFTAVSLIAVLLW 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 117/562 (21%)
scav-4NP_510157.2 CD36 11..533 CDD:279474 114/555 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.