DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and scav-2

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_499802.3 Gene:scav-2 WormBaseID:WBGene00013578 Length:558 Species:Caenorhabditis elegans

Alignment Length:469 Identity:91/470 (19%)
Similarity:179/470 (38%) Gaps:85/470 (18%)


  Fly     1 MKSVQWVKILLCLILACVNVFLFVVSWGVDYRILVAR-------EHIRFRQEMPTMDSWINSPFG 58
            |:.:...::::..:|..:..||...|. :.:.::|.:       |:.|........:.|....:.
 Worm    26 MRRMSCCQLVISAVLIGLGSFLLFGSL-ITHTVVVPKVVKSSIEENSRLVNGSIMWEKWAMPEYK 89

  Fly    59 -KLKNYVFNVTNAEEFRSGRDSRLKVKEI---GPIVYRIVGFNDILDRNETNVRYRKHRYRVVEF 119
             :...||::..|.:||.:|     .:.|:   ||.|:.....|.::......|:||  |:....|
 Worm    90 IRFNMYVYSTKNPDEFMNG-----AIPEVTGSGPYVFDKKMENRVVSAENGTVKYR--RFFTYNF 147

  Fly   120 LPEESVAPDVLNWTITSTNNV----ILGAATKVKHTAPLAAFGFDAA---LMMEDIFVTDSVYYF 177
            ..:||....:|...|...|.:    :..|:|:          |..||   |:.:..|:...|...
 Worm   148 NEQESCQTCILGNRIWVPNMIYQKFVEAASTE----------GMKAAATTLLSQTAFLEVEVEEL 202

  Fly   178 LWE-FTRPLLQTLSRIS----------NIRPNVAVLYNALKEKEEVYTVNIGPKRGIENFFRIET 231
            |:| :..|.|..:..|.          ::...:.:.:.|.....:||.::.| .|..::..:|.:
 Worm   203 LFEGYKDPFLDKVCEIPFMNFVCEAILDVPERIGLFFKANGTGSKVYEIDDG-TRNPDDLGKILS 266

  Fly   232 LNGEVIIREQLPHTRQYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQER 296
            .:...|:.|      .:.|......:.|. |.|||.||:.....|.:...|.||.:.|.::.:..
 Worm   267 YDESPILDE------TWWSTDESLKIKGT-DGSLFHPFLSKHEKLYVYVAELCRSIWLEFKEEVE 324

  Fly   297 YNGLDTFRYTLLQSHQKPPGCLDTSYGVK---------------------LPDGMFDVSQCVIND 340
            |.||..:|:.:      ||...|.::...                     :|.|:.::|:|..:.
 Worm   325 YRGLKAYRFVV------PPEVFDVTHPGNQGFCNPSEKQFYESQNDSSNCMPKGLLEISKCQQSQ 383

  Fly   341 APSAFSMPHFYGSSYNWSQHYEGYTPNAEDHEPYIL-LEPVTGIPVTEKYRFQSNIPIPDLRR-- 402
            .|...|:|:|..:........:|.....|..:..:: :||..|..:..:...|.||.:...:.  
 Worm   384 PPITISLPNFLFAPSEVRGSVKGLNETDEIRDSIVVDIEPRVGAVLYARRVSQVNIEMWKGKNLT 448

  Fly   403 FSSRLSRFSNMMIP 416
            |...|.:..:.:||
 Worm   449 FPVNLKKMKSALIP 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 90/461 (20%)
scav-2NP_499802.3 CD36 46..505 CDD:279474 89/450 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.651 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.