DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and Scarb2

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_031670.1 Gene:Scarb2 MGIID:1196458 Length:478 Species:Mus musculus

Alignment Length:460 Identity:110/461 (24%)
Similarity:187/461 (41%) Gaps:83/461 (18%)


  Fly    11 LCLILACVNVFLFVV---SWGVDYRILVAREHIRFRQEMPTMDSWINSPFG-KLKNYVFNVTNAE 71
            |.|:|...:|.|.|.   ...||..|   .:::..:......:||...|.. .::.|.|||||.|
Mouse    12 LSLLLLVTSVTLLVARVFQKAVDQTI---EKNMVLQNGTKVFNSWEKPPLPVYIQFYFFNVTNPE 73

  Fly    72 EFRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETNVRYRKH-------RYRVVEFLPEESVA-PD 128
            |...|....|  :|:||..||.:       ||:.|:::.::       ..:...|...:||. |:
Mouse    74 EILQGEIPLL--EEVGPYTYREL-------RNKANIQFGENGTTISAVTNKAYVFERNQSVGDPN 129

  Fly   129 VLNWTITSTNNVILGAATKVKHTAPLAAFGFDAAL--MMEDIFVTDSVYYFLWEFTRPLLQTLSR 191
            |   .:..|.|:.|.....:.....|... .:|.|  ..:.:||..:|:..||.:...:|..:..
Mouse   130 V---DLIRTINIPLLTVVDLAQLTLLREL-IEAMLKAYQQKLFVIHTVHELLWGYKDEILSLVHI 190

  Fly   192 IS-NIRPNVAVLY--NALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLPHTRQYDSNSC 253
            .. ::.||..:.|  |...:.|.|:...   :....||.:|...||:..:       ..:.:::|
Mouse   191 FKPDVSPNFGLFYERNGTNDGEYVFLTG---EDNYLNFSKIVEWNGKTSL-------DWWTTDTC 245

  Fly   254 PFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRY----TLLQSHQKP 314
              |:....|...|.|.:..|..|.:...:.||.:.:|:...|...||..|||    .:|.:..:.
Mouse   246 --NMINGTDGDSFHPLISKDEVLYLFPSDLCRSVHITFSSFENVEGLPAFRYKVPAEILANTSEN 308

  Fly   315 PG-------CLDTSYGVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYEGYTPNAEDHE 372
            .|       |:|:        |:.::|.|. |.||...|.||||.:...:....:|..||.|:||
Mouse   309 AGFCIPEGNCMDS--------GVLNISICK-NGAPIIMSFPHFYQADEKFVSAIKGMHPNKEEHE 364

  Fly   373 PYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIPSFWYEFEMGQLPGFVTSLMWI 437
            .::.:.|:|||.:....|||.|..:..|..|                  .|.|.:...|..:|::
Mouse   365 SFVDINPLTGIILRGAKRFQINTYVRKLDDF------------------VETGDIRTMVFPVMYL 411

  Fly   438 NVNIV 442
            |.:::
Mouse   412 NESVL 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 110/461 (24%)
Scarb2NP_031670.1 CD36 28..455 CDD:279474 104/445 (23%)
Important for interaction with GBA 155..191 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.