DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and Scarb2

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_446453.1 Gene:Scarb2 RGDID:621882 Length:478 Species:Rattus norvegicus

Alignment Length:514 Identity:129/515 (25%)
Similarity:204/515 (40%) Gaps:114/515 (22%)


  Fly    11 LCLILACVNVFLFVV---SWGVDYRILVAREHIRFRQEMPTMDSWINSPFG-KLKNYVFNVTNAE 71
            |.|:|...:|.|.|.   ...||..|   .:::..:......|||...|.. .::.|.|||||.|
  Rat    12 LSLLLLVTSVTLLVARVFQKAVDQTI---EKNMVLQNGTKVFDSWEKPPLPVYIQFYFFNVTNPE 73

  Fly    72 EFRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETNVRYRKH-------RYRVVEFLPEESVAPDV 129
            |...|....|  :|:||..||.:       ||:.||::.::       ..:...|...:||....
  Rat    74 EILQGEIPLL--EEVGPYTYREL-------RNKANVQFGENGTTISAVTNKAYIFERNQSVGDPT 129

  Fly   130 LNWTITSTNNVILGAATKVKHTAPLAAFGFDAAL--MMEDIFVTDSVYYFLWEFTRPLLQTLSRI 192
            ::  :..|.|:.|....::.. .|......:|.|  ..:.:|||.:|:..||.:...:| :|..|
  Rat   130 VD--LIRTINIPLLTVVEMAQ-QPFLREIIEAMLKAYQQTLFVTHTVHELLWGYKDEVL-SLVHI 190

  Fly   193 --SNIRPNVAVLY--NALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLPHTRQYDSNSC 253
              .::.||..:.|  |...:.|.|:...   :....||.:|...||:..:       ..:.:::|
  Rat   191 FRPDVSPNFGLFYERNGTNDGEYVFLTG---EDNYLNFTKIVEWNGKTSL-------DWWTTDTC 245

  Fly   254 PFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRY-----TLLQSHQK 313
              |:....|...|.|.:..|..|.|...:.||.:.:|:...|...||..|||     .|..|.:.
  Rat   246 --NMINGTDGDSFHPLISKDETLYIFPSDFCRSVYITFSSFENVEGLPAFRYKVPAEILANSSEN 308

  Fly   314 -----PPG-CLDTSYGVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYEGYTPNAEDHE 372
                 |.| |:|.        |:.:||.|. |.||...|.||||.:...:....:|..||.|:||
  Rat   309 AGFCIPEGNCMDA--------GVLNVSICK-NGAPIIMSFPHFYQADEKFVSAIKGMRPNKEEHE 364

  Fly   373 PYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIPSFWYEFEMGQLPGFVTSLMWI 437
            .::.:.|:|||.:....|||.|..:..|..|                  .|.|.:...|..:|::
  Rat   365 SFVDINPLTGIILRGAKRFQINTYVKKLDDF------------------VETGNIRTMVFPVMYL 411

  Fly   438 N----------------VN---IVQHIQPYCM----VLFLVLALWSVLKAIRVACGDLG 473
            |                :|   ||.:| ||.:    |.|.::..|       :||...|
  Rat   412 NESVLIDKETASQLKSVINTTLIVTNI-PYIIMALGVFFGLIFTW-------LACRGQG 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 126/502 (25%)
Scarb2NP_446453.1 CD36 28..455 CDD:279474 119/483 (25%)
Important for interaction with GBA. {ECO:0000250} 155..191 11/37 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.