DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and LOC103690020

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_006236024.1 Gene:LOC103690020 RGDID:9322705 Length:472 Species:Rattus norvegicus

Alignment Length:401 Identity:97/402 (24%)
Similarity:165/402 (41%) Gaps:74/402 (18%)


  Fly    63 YVFNVTNAEEFRSGRDSRLKVKEIGPIVYRI---VGFNDILDRNETNVRYRKHRYRVVEFLPEES 124
            ::|:|.|.||. :...|::|||:.||..||:   ...|...|..::.|.:.:....:.|  |..|
  Rat    66 WIFDVQNPEEV-AKNSSKIKVKQRGPYTYRVRYLAKENITQDPKDSTVSFVQPNGAIFE--PSLS 127

  Fly   125 VAPDVLNWTITSTNNVILGAATKVKHTAPLAAFGFDAALM-------MEDIFVTDSVYYFLWEFT 182
            |..:..|:|:.   |:.:.||..:...:      |...::       ...:|.|.|:...||.:.
  Rat   128 VGTENDNFTVP---NLAVAAAPHIYQNS------FIQGVLNNLIKKSKSSMFQTRSLKELLWGYK 183

  Fly   183 RPLLQTLSRISNIRPNVAVLYNALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLPHTRQ 247
            .|.|..:.  ..|...|.|.|......:.||.|..| |..|.....|:|..|    :..|.:.:.
  Rat   184 DPFLSLIP--YPISTTVGVFYPYNNTVDGVYKVFNG-KDNINKVAIIDTYKG----KRNLSYWKS 241

  Fly   248 YDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRYTL----- 307
            |    |.. ::|. |.:.|||||:....|...:.:.||.:...::.:....|:..:|:.|     
  Rat   242 Y----CDM-INGT-DAASFPPFVEKSRTLRFFSPDICRSIYAVFESEVNLKGIPVYRFVLPVNAF 300

  Fly   308 ---LQSHQKPPGCLD-------TSYGVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYE 362
               ||:......|.:       |||||      .|:.:|. ...|...|:|||..:|.:.|:..:
  Rat   301 ASPLQNPDNHCFCTEKVISNNCTSYGV------LDIGKCK-EGKPVYISLPHFLHASPDVSEPIQ 358

  Fly   363 GYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIPSFWYEFEMGQL 427
            |..||.::|..|:.:||:||..:....|.|.||.:...|    ::....|:..|           
  Rat   359 GLNPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPAR----KIEALKNLKRP----------- 408

  Fly   428 PGFVTSLMWIN 438
              ::..::|:|
  Rat   409 --YIVPILWLN 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 97/402 (24%)
LOC103690020XP_006236024.1 CD36 16..461 CDD:279474 97/402 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.