DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and scarb1

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_002935333.1 Gene:scarb1 XenbaseID:XB-GENE-494666 Length:505 Species:Xenopus tropicalis

Alignment Length:509 Identity:124/510 (24%)
Similarity:216/510 (42%) Gaps:122/510 (24%)


  Fly     9 ILLCLILACVNVFLFVVSWGVDYRILVAREHIR------FRQEMPTMDSW--INSPFGKLKNYVF 65
            :|..|::....:.:|:|...:|.::   .:::|      |..||     |  :..|| .:..|:|
 Frog    14 VLGVLLVGVGTLLVFLVPVIMDEQV---EKNVRIDPSSGFAYEM-----WRDLPVPF-YMSIYIF 69

  Fly    66 NVTNAEEFRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETNVRYRKH------RYRVVEFLPEES 124
            .|.|.:|...|...:|  :|.||.|||..       :.:.|:.:.::      .:|...|.||:|
 Frog    70 EVVNHKEVLLGEKPQL--QERGPYVYREY-------KKKQNITFNENGTVSFVEFRTFHFDPEKS 125

  Fly   125 --------VAPDVLNWTITSTNNVI--LGAATKVKHTAPLAAFGFDAALMMEDIFVTDSVYYFLW 179
                    :.|::|   :..::.::  ||.|.|...:...:||.       |:.|:..:|...||
 Frog   126 NGKEEDHVIVPNIL---VLGSSVMLQDLGIAIKWIISGAFSAFN-------EEAFINKTVKDILW 180

  Fly   180 EFTRPLLQTLSRISNIRPNVAVLYNALKEKEE-------------VYTVNIGPKRGIENFFRIET 231
            .:..|.|..|:         ..|...|..|.:             |:|||    .|:|:..|::.
 Frog   181 GYEDPFLDFLN---------TFLPGKLPFKGKFGFFSDFNNSNTGVFTVN----TGMEDISRVQM 232

  Fly   232 L---NGEVIIREQLPHTRQYDS-NSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQ 292
            :   ||          .::.|. ||...|:.......::|||.:|..||...:.::||.:.|.|:
 Frog   233 VDNWNG----------LKKVDFWNSEQTNMINGTAGQMWPPFRKPSEPLEFYSPDACRSMKLVYE 287

  Fly   293 RQERYNGLDTFRYT-----LLQSHQKPPG---CLDTSYGVKLPDGMFDVSQCVINDAPSAFSMPH 349
            ::|::.|:.|||||     .......||.   |...:.||:      :||.|..| ||...|.||
 Frog   288 KEEKFRGIPTFRYTAPNYLFANGSDYPPNEGFCPCVASGVQ------NVSACRFN-APLFLSFPH 345

  Fly   350 FYGSSYNWSQHYEGYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSS---RLSRFS 411
            ||.:...:.:..||..|..|.|..::.:.|:||||:....:.|.|:    |.:..|   :..:..
 Frog   346 FYNADPGFLESVEGLHPTEELHSLFLDMHPLTGIPMNCSIKMQLNM----LTKSVSGIMQTGQIK 406

  Fly   412 NMMIPSFWYEFEMGQLPGFVTS-------LMWINVNIVQHIQPYCMVLFLVLAL 458
            .:::|..|:. |.|.|.|.|.:       ||.|.:..:|::.....:.|:.:||
 Frog   407 PVILPVLWFA-ESGHLDGPVYNTYYNILILMPIVLEYLQYVLIGIGLCFITVAL 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 124/509 (24%)
scarb1XP_002935333.1 CD36 29..460 CDD:279474 121/495 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50677748
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.741 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.