DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2736 and cd36

Sequence 1:NP_611991.1 Gene:CG2736 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001107151.1 Gene:cd36 XenbaseID:XB-GENE-493679 Length:470 Species:Xenopus tropicalis

Alignment Length:408 Identity:91/409 (22%)
Similarity:156/409 (38%) Gaps:84/409 (21%)


  Fly    50 DSWINSPFGKLKNY-VFNVTNAEEFRSGRDSRLKVKEIGPIVYRI--VGFNDILDRNETNVRYRK 111
            ::||.:.....::: :::|||.:|..:|....|:.|  ||..||:  :...:|.......|.|.:
 Frog    52 ENWIEAGSPVYRHFWIYHVTNPDEIINGGKPILQQK--GPYTYRVRYLPKENITQLENNTVSYWQ 114

  Fly   112 HRYRVVEFLPEESVAPD-----VLNWTITSTNNV------ILGAATKVKHTAPLAAFGFDAALMM 165
            ....:  |..|.|..|:     |||..:.:...:      :|.|..|..:::             
 Frog   115 PNGAI--FQREGSYGPEEDTYTVLNLAVAAAPAMFPALQGLLNAIIKSSNSS------------- 164

  Fly   166 EDIFVTDSVYYFLWEFTRPLLQTLSRISNIRPNVAVLYNALKEKEEVYTVNIGPKRGIENFFRIE 230
              :|...||...||.:..|.|:.:. |.:|.....:.|           .|.|...||.:.:   
 Frog   165 --LFQVRSVKELLWGYRDPFLEKIP-IDSIDKTTGLFY-----------PNNGTADGIYHVY--- 212

  Fly   231 TLNGEVIIREQLPHTRQYDSNSCPF------NVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPL 289
              ||:..|.:.....|..::.:.|:      ::....|.:.|||.|:.|..|...:.|.||.:..
 Frog   213 --NGKGDISKVAIIDRYKEAKALPYWNDDFCDMINGTDAASFPPSVKKDKRLYFFSSEICRSIYG 275

  Fly   290 TYQRQERYNGLDTFRYTLLQSHQKPPGCLDTSYGVKLPD-----------------GMFDVSQCV 337
            .::::....|:..:|:.:.:.....|        .|.||                 |:.|:..|.
 Frog   276 IFEKEYMVKGIKLYRFVVTEDAMASP--------TKNPDNHCFCKDFQLSRNCTAAGVLDLRSCQ 332

  Fly   338 INDAPSAFSMPHF-YGSSYNWSQHYEGYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLR 401
             ...|...|:||| |.|.| ......|..||.|:||.||.:||:||..:....|.|.|:.|....
 Frog   333 -GGKPIFLSLPHFLYASDY-LLDSVSGLKPNKEEHETYIDVEPITGFTMHFAKRLQVNVMIQPTD 395

  Fly   402 RFSSRLSRFSNMMIPSFW 419
            :........|.::.|..|
 Frog   396 KIEVMSKLQSELVFPVAW 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 91/409 (22%)
cd36NP_001107151.1 CD36 16..459 CDD:279474 91/409 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.