DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and DNAJC30

DIOPT Version :10

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_115693.2 Gene:DNAJC30 / 84277 HGNCID:16410 Length:226 Species:Homo sapiens


Alignment Length:245 Identity:60/245 - (24%)
Similarity:74/245 - (30%) Gaps:102/245 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYEVLSDPQERSWYDNHR 69
            |:.|.:...|....||:||.:....:|||:|... |||.|||..|.|||.||.....|..||   
Human    51 YDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGS-AEAAERFTRISQAYVVLGSATLRRKYD--- 111

  Fly    70 EQILRGKNSDYAENCLDVFQFFTSSCYKGYGDNEHGFYRVYTDVFVQIASEDLEFMDKDDRLGMA 134
                ||..||                                        |||...........|
Human   112 ----RGLLSD----------------------------------------EDLRGPGVRPSRTPA 132

  Fly   135 PDFGHSNSSYEDVVGPFYAFWQAYSTRKTYDWLCPYDVREIKERFILRKVEKEMKKIVQAARKER 199
            ||.|...:.      |        .|.:|:|                            .:|...
Human   133 PDPGSPRTP------P--------PTSRTHD----------------------------GSRASP 155

  Fly   200 NEEVRNLVNFVRKRDPRVQA-YRRMLEERVEANRLKQEEKRKEQLRKRQE 248
            ... |.:.||    |...|| |...||      |.::...|:|.||||||
Human   156 GAN-RTMFNF----DAFYQAHYGEQLE------RERRLRARREALRKRQE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 terminal_TopJ 2..>154 CDD:468284 38/148 (26%)
PRK10767 2..>66 CDD:236757 24/60 (40%)
PRK12704 170..>272 CDD:237177 19/80 (24%)
PTZ00108 <182..437 CDD:240271 19/68 (28%)
zf-C2H2_jaz 313..337 CDD:432381
C2H2 Zn finger 315..337 CDD:275371
DNAJC30NP_115693.2 DnaJ 50..111 CDD:395170 24/60 (40%)
PRK14299 51..>173 CDD:237667 48/216 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..157 14/122 (11%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.