DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and dnajc5ab

DIOPT Version :10

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_001338363.1 Gene:dnajc5ab / 797907 ZFINID:ZDB-GENE-081021-2 Length:199 Species:Danio rerio


Alignment Length:195 Identity:55/195 - (28%)
Similarity:85/195 - (43%) Gaps:59/195 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYEVLSDPQERSWYDNH- 68
            |..|.:::|....|||.:|||:||::||||||:. .||.::|:.|..|:.:||||.:|:.||.: 
Zfish    18 YVVLGVEKNTAQEDIKKSYRKLALKFHPDKNPNN-PEAADKFKEINNAHAILSDPTKRNIYDKYG 81

  Fly    69 ------REQILRGKN--------SDYAENCLDVFQFFTSSCY----------------KGY--GD 101
                  .||.  |:.        |.:....|.:|....:.||                |.:  ..
Zfish    82 SLGLYVAEQF--GEENVNTYFVLSSWWAKALFIFCGVATGCYFCCCLCCCCNCCCGKCKPHPPHS 144

  Fly   102 NEHGFYRVYTDVFVQIASEDLEF-MDKDDRLGMAPDFGHSNSSYEDVVGPFYAFWQAYSTRKTYD 165
            ::..||         ::.||||. |..|:|.|.:|.....:|:.|             ||:.|.|
Zfish   145 DDPDFY---------VSPEDLEAQMQSDERDGSSPIMMQPSSATE-------------STQLTAD 187

  Fly   166  165
            Zfish   188  187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 terminal_TopJ 2..>154 CDD:468284 51/182 (28%)
PRK10767 2..>66 CDD:236757 27/60 (45%)
PRK12704 170..>272 CDD:237177
PTZ00108 <182..437 CDD:240271
zf-C2H2_jaz 313..337 CDD:432381
C2H2 Zn finger 315..337 CDD:275371
dnajc5abXP_001338363.1 PRK10767 18..>81 CDD:236757 29/63 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.