DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and dnajc5gb

DIOPT Version :10

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_005158621.1 Gene:dnajc5gb / 393371 ZFINID:ZDB-GENE-040426-1238 Length:212 Species:Danio rerio


Alignment Length:92 Identity:36/92 - (39%)
Similarity:54/92 - (58%) Gaps:3/92 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYEVLSDPQERSWYDNHR 69
            |:.|.||:.|:..|||.||||:||:.||||||:. .||.|:|:.|..|..:|:|..:|..||.:.
Zfish    19 YQTLGLQKGASSEDIKKAYRKLALKHHPDKNPNN-PEAAEKFKEINNANSILNDETKRQIYDEYG 82

  Fly    70 EQILRGKNSDYAENCLDVFQFFTSSCY 96
            ...|...: .:.|:.:. :.|..|.|:
Zfish    83 SMGLYIAD-QFGEDSVK-YYFLMSKCW 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 terminal_TopJ 2..>154 CDD:468284 36/92 (39%)
PRK10767 2..>66 CDD:236757 29/60 (48%)
PRK12704 170..>272 CDD:237177
PTZ00108 <182..437 CDD:240271
zf-C2H2_jaz 313..337 CDD:432381
C2H2 Zn finger 315..337 CDD:275371
dnajc5gbXP_005158621.1 DnaJ 17..79 CDD:395170 29/60 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.