DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and Dnajc30

DIOPT Version :10

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001102494.1 Gene:Dnajc30 / 368190 RGDID:1595783 Length:219 Species:Rattus norvegicus


Alignment Length:213 Identity:55/213 - (25%)
Similarity:80/213 - (37%) Gaps:57/213 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYEVLSDPQERSWYDNH- 68
            |:.|.:...|....||:||.:.:..:|||:||.. .||.|||..|.:||.||.....|..||.. 
  Rat    44 YDLLGVPSTATQAQIKAAYYRQSFLYHPDRNPGS-TEAAERFTRISEAYLVLGSTILRRKYDRGL 107

  Fly    69 -REQILRG-----KNSDYAENCLDVFQFFTSSCYKGYGDNEHGFYRVYTDVFVQIASEDLEFMDK 127
             .:|.|||     ..:..|:.        |......|....||..|         ||:       
  Rat   108 LSDQDLRGPGVKPSKTPVADP--------TPPRPPPYTPRAHGGSR---------ASQ------- 148

  Fly   128 DDRLGMAPDFGHSNSSYEDVVGPFYAFWQAYSTRKTYDWLCPYDVREIKERFILRKVEKEMKKIV 192
                      |...:.::     |.||:||:     |......:.|....|..|||.:|:     
  Rat   149 ----------GDGRTMFD-----FDAFYQAH-----YGEQLERERRLRARREALRKKQKD----- 188

  Fly   193 QAARKERNEEVRNLVNFV 210
            .|::..|.::.|:...||
  Rat   189 HASKGPRWDDTRDATFFV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 terminal_TopJ 2..>154 CDD:468284 39/155 (25%)
PRK10767 2..>66 CDD:236757 23/60 (38%)
PRK12704 170..>272 CDD:237177 11/41 (27%)
PTZ00108 <182..437 CDD:240271 8/29 (28%)
zf-C2H2_jaz 313..337 CDD:432381
C2H2 Zn finger 315..337 CDD:275371
Dnajc30NP_001102494.1 DnaJ 43..104 CDD:395170 23/60 (38%)
PRK10266 44..>168 CDD:182347 44/168 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.