DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and DNAJC5G

DIOPT Version :10

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_775921.1 Gene:DNAJC5G / 285126 HGNCID:24844 Length:189 Species:Homo sapiens


Alignment Length:80 Identity:31/80 - (38%)
Similarity:44/80 - (55%) Gaps:17/80 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YEELELQRNANDGDIKSAY----------------RKMALRWHPDKNPDRLAEAKERFQLIQQAY 53
            |..|:|::.|:..|.|.:|                ||:|||:||||||.. |:|.|.|:.|..|:
Human    19 YAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGN-AQAAEIFKEINAAH 82

  Fly    54 EVLSDPQERSWYDNH 68
            .:|||.::|..||.|
Human    83 AILSDSKKRKIYDQH 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 terminal_TopJ 2..>154 CDD:468284 31/80 (39%)
PRK10767 2..>66 CDD:236757 28/76 (37%)
PRK12704 170..>272 CDD:237177
PTZ00108 <182..437 CDD:240271
zf-C2H2_jaz 313..337 CDD:432381
C2H2 Zn finger 315..337 CDD:275371
DNAJC5GNP_775921.1 PRK10767 19..>98 CDD:236757 31/80 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..189
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.