DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and dnj-28

DIOPT Version :10

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_491084.1 Gene:dnj-28 / 171870 WormBaseID:WBGene00001046 Length:494 Species:Caenorhabditis elegans


Alignment Length:111 Identity:37/111 - (33%)
Similarity:57/111 - (51%) Gaps:19/111 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RCYYEELELQRNANDGDIKSAYRKMALRWHPDKNPD--RLAEAKERFQLIQQAYEVLSDPQERSW 64
            |.||:.|.::||||..:|..||||||.:||||...|  ...:|:::|..|..|.||||:.::|..
 Worm   379 RDYYKILGVRRNANKREITKAYRKMAQKWHPDNFQDEKEKKKAEKKFIDIAAAKEVLSNEEKRRA 443

  Fly    65 YDNHREQILRGKNSDYAENCLDVFQFFTSSCYKGYGDNEHGFYRVY 110
            :||.::.:    :|:....             .|.|...|||:..:
 Worm   444 FDNGQDPL----DSEAGRG-------------GGGGGGSHGFHNFH 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 terminal_TopJ 2..>154 CDD:468284 37/111 (33%)
PRK10767 2..>66 CDD:236757 29/65 (45%)
PRK12704 170..>272 CDD:237177
PTZ00108 <182..437 CDD:240271
zf-C2H2_jaz 313..337 CDD:432381
C2H2 Zn finger 315..337 CDD:275371
dnj-28NP_491084.1 NlpI <23..>122 CDD:443815
TPR repeat 28..52 CDD:276809
TPR repeat 57..87 CDD:276809
TPR repeat 92..116 CDD:276809
LapB 167..>363 CDD:442196
TPR repeat 175..203 CDD:276809
TPR repeat 208..238 CDD:276809
TPR repeat 291..321 CDD:276809
TPR repeat 326..352 CDD:276809
DnaJ 380..445 CDD:395170 28/64 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.