DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and Dnajc5

DIOPT Version :10

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_058055.1 Gene:Dnajc5 / 13002 MGIID:892995 Length:198 Species:Mus musculus


Alignment Length:155 Identity:47/155 - (30%)
Similarity:68/155 - (43%) Gaps:36/155 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYEVLSDPQERSWYDNH- 68
            |..|.|.:||...|||.:|||:||::|||||||. .||.::|:.|..|:.:|:|..:|:.||.: 
Mouse    17 YHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDN-PEAADKFKEINNAHAILTDATKRNIYDKYG 80

  Fly    69 ------REQILRGKN--------SDYAENCLDVFQFFTSSCY------------------KGYGD 101
                  .||.  |:.        |.:....|.|.....:.||                  |....
Mouse    81 SLGLYVAEQF--GEENVNTYFVLSSWWAKALFVVCGLLTCCYCCCCLCCCFNCCCGKCKPKAPEG 143

  Fly   102 NEHGFYRVYTDVFVQIASEDLEFMD 126
            .|..||....|:..|:.|::.|..|
Mouse   144 EETEFYVSPEDLEAQLQSDEREATD 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 terminal_TopJ 2..>154 CDD:468284 47/155 (30%)
PRK10767 2..>66 CDD:236757 28/60 (47%)
PRK12704 170..>272 CDD:237177
PTZ00108 <182..437 CDD:240271
zf-C2H2_jaz 313..337 CDD:432381
C2H2 Zn finger 315..337 CDD:275371
Dnajc5NP_058055.1 PRK10767 17..>80 CDD:236757 30/63 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.