DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tina-1 and ggact.2

DIOPT Version :10

Sequence 1:NP_611983.2 Gene:Tina-1 / 37989 FlyBaseID:FBgn0035083 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001004544.1 Gene:ggact.2 / 447805 ZFINID:ZDB-GENE-040912-8 Length:191 Species:Danio rerio


Alignment Length:152 Identity:62/152 - (40%)
Similarity:81/152 - (53%) Gaps:11/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LFVYGALKYGQPSNSILASSGNGFAKFWCKATTTQKLPLVIATRYNIPFLLNKPGVGYYVTGEIY 78
            :||||.||.|||:...|..|.||.|:|...|.|.:..||||....|||||||.||.|..|.||||
Zfish     4 VFVYGTLKKGQPNYFRLIDSSNGQAEFITCARTVEPYPLVITGECNIPFLLNVPGSGQRVYGEIY 68

  Fly    79 EVDDRMLNSLDNLEDCEEIYTREMHDMNI--GVGEGTV-PCWVYLLQKYPENLLSLRYLSSYENS 140
            .||.:||..||..|:|.:.|.|.:..:.|  |.||..| ..:||...||..:.|:.....||:::
Zfish    69 SVDQKMLEFLDWFEECPDWYQRTLIQLEILKGNGETEVEEAFVYTKTKYEPDWLNKPTYDSYDSN 133

  Fly   141 TTHPYIMRHRRTHKHPAQDDLT 162
            ..|..        |:..::|:|
Zfish   134 GDHGL--------KYAYEEDMT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tina-1NP_611983.2 GGACT 14..131 CDD:428763 56/119 (47%)
ggact.2NP_001004544.1 GGACT 4..131 CDD:428763 57/126 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..191
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.