DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and hpo-12

DIOPT Version :8

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001255632.1 Gene:hpo-12 / 36804989 WormBaseID:WBGene00016588 Length:313 Species:Caenorhabditis elegans

Alignment Length:311 Identity:108/312 (35%)
Similarity:159/312 (51%) Gaps:25/312 (8%)


  Fly     2 PE--NSVVVQLMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYA 64
            ||  |..:.....:..|..:|..||.|.|||||||||||:|.||:...|..||:||:.:...:..
 Worm     6 PEAINEPLTSAEYSEAGLASGIVTRMIIQPLDVLKIRFQLQEEPIRGKKSGKYKGVMQSIFLITR 70

  Fly    65 EEGMRGMFRGHNSGQVLSISYALVQFWSYEQLRSMAHQF---DYWRERPFLMFFICGGIAGCLGA 126
            |||....::||...|.||.:|.||||.|:|.|...|.:.   |....|. ...|.||.::|||..
 Worm    71 EEGAHAFWKGHIPAQGLSATYGLVQFSSFEWLSQQAAKVIPADNQSVRS-TSDFACGALSGCLAM 134

  Fly   127 VAAQPFDVVRTQMVAADPSSRRSQMNTFTG----LRKVYKMEGWMGLSRGLPFTLVQVFPLVGAN 187
            .||.|.||:||::||     :::....:||    ::.:::.||..|..||...::||:.|..|..
 Worm   135 TAAMPLDVIRTRLVA-----QKAGHAVYTGTMHAVKHIWEKEGIAGYFRGWVPSVVQIAPFTGMQ 194

  Fly   188 FLFYKYLNAAVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTF 252
            |..|.     ..|...|....|..|| || :||::|.:||.::||.|:::.|:|:..|  ||..|
 Worm   195 FALYN-----CFMDLWPFNGYESAGA-LF-SGAMAGTVAKTVLYPLDMVRHRLQMNGF--ERAGF 250

  Fly   253 GRNPE-CPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMF 302
            |:... ...:...|....:.|...|.:||:.|:.:||...|...|..|::|
 Worm   251 GKTSNYSQGLFKTIGMVVKNESWYGLFKGLWPSQIKAAANSGCAFLFYEIF 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 103/289 (36%)
Mito_carr 23..99 CDD:278578 38/76 (50%)
Mito_carr 108..194 CDD:278578 29/90 (32%)
Mito_carr 216..307 CDD:278578 28/89 (31%)
hpo-12NP_001255632.1 Mito_carr 11..102 CDD:278578 39/91 (43%)
PTZ00169 21..300 CDD:240302 104/294 (35%)
Mito_carr 115..209 CDD:278578 31/105 (30%)
Mito_carr 216..309 CDD:278578 29/90 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003448
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.