DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atf-2 and Creb5

Sequence 1:NP_001033973.1 Gene:Atf-2 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001128093.1 Gene:Creb5 RGDID:1566107 Length:561 Species:Rattus norvegicus

Alignment Length:441 Identity:102/442 (23%)
Similarity:152/442 (34%) Gaps:166/442 (38%)


  Fly    29 CYQNFRAQTEHVSL-----DISL---GQKSDTLFAADQTPTPTRLIKNCDEVGLFEDLQHVNPFD 85
            |.|.|..: :|:.:     :::|   ..|:|.:. :||||||||.:|||:|||||.:|.  ..|:
  Rat    76 CSQRFPTE-DHLMIHRHKHEMTLKFPSIKTDNML-SDQTPTPTRFLKNCEEVGLFSELD--CSFE 136

  Fly    86 IGFQQAAE-----RNVS------GTPSRPEAR-------PNDGESLHTPQVY--PVEAPTVVSVP 130
            ..|::|.|     ||:|      ||.:.|.|.       ||...|:...|..  |..:..:...|
  Rat   137 HEFRKAQEEESSKRNISMHNTVGGTMTGPGAHQLGSSRMPNHDTSVVIQQAMPSPQSSSVITQAP 201

  Fly   131 SENQ----VPQSVSCGDMDVDQL--LATTVTSPSKASQDG--PPPLQLIQPQVLTWVLPAQSVPI 187
            |.|:    ||.|:|       .|  |......|..||..|  |.|.......||..:....||..
  Rat   202 STNRQIGPVPGSLS-------SLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNS 259

  Fly   188 SIATVD-------CNRNRVKPT------------------------------------------- 202
            ||..:.       |...:|:|.                                           
  Rat   260 SIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMSTIGHMMEMMGSRQDQTPH 324

  Fly   203 -------------------------GAIHPFILPKPTAKE----------------LNKTSKRPE 226
                                     .|.||.  |:|..::                .::||  |.
  Rat   325 HHMHSHPHQHQTLPPHHPYPHQHQHPAHHPH--PQPHHQQNHPHHHSHSHLHAHPAHHQTS--PH 385

  Fly   227 PILVSCNPPNNEPSSASLTPTSQL----PIKERLKAIIHS--NNNRRSFSTPPKAAKAKDRSRDE 285
            |.|.:.|.....|::..:.||..:    |...|.:.::..  :..||.|                
  Rat   386 PPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKF---------------- 434

  Fly   286 DCMERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHERISRLEKELQQ 336
              :||.||||:|.|.|.:.....|.|:..:|.|.|.:|...:|.|:.|:.|
  Rat   435 --LERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQ 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 10/36 (28%)
Creb5NP_001128093.1 bZIP_ATF2 430..489 CDD:269835 22/73 (30%)
coiled coil 430..489 CDD:269835 22/73 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D415378at33208
OrthoFinder 1 1.000 FOG0000376
OrthoInspector 1 1.000 T618052
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19304
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.