DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atf-2 and FOS

Sequence 1:NP_001033973.1 Gene:Atf-2 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_005243.1 Gene:FOS HGNCID:3796 Length:380 Species:Homo sapiens

Alignment Length:313 Identity:76/314 (24%)
Similarity:112/314 (36%) Gaps:107/314 (34%)


  Fly    84 FDIGFQQAAERNVSGTPSRPEARPNDGESL---HTP------QVYPVEAP---TVVSVPSENQVP 136
            |:..::.::.|..|.:|:        |:||   |:|      ...||.|.   |.::|.|.|.:|
Human     6 FNADYEASSSRCSSASPA--------GDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIP 62

  Fly   137 QSVSCGDMDVDQLLATTVTSPSKASQDGPPPLQ-LIQPQVLTWVLPAQSVPISIATVDCNRNRVK 200
                            |||:.|.:     |.|| |:||.:::.|.|:|                 
Human    63 ----------------TVTAISTS-----PDLQWLVQPALVSSVAPSQ----------------- 89

  Fly   201 PTGAIHPFILPKPTAKELNKTSKRPEPILVSCNPPNNEPSSASLTPTSQLPIKERLKAIIHSNNN 265
             |.|.|||.:|.|:|...::..      :|.........|........||..:|..|..|     
Human    90 -TRAPHPFGVPAPSAGAYSRAG------VVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRI----- 142

  Fly   266 RRSFSTPPKAAKAKDRSRDEDCMERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHERISRL 330
            ||                     ||.:.||::.||:.|.....|..:..||:.|...|...|:.|
Human   143 RR---------------------ERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANL 186

  Fly   331 EKE-------LQQHRSHSSLAGVVADQLRIPP----SSIHLLINVPNVLVPSS 372
            .||       |..||.    |..:.|.|..|.    :|:.|...:|.|..|.|
Human   187 LKEKEKLEFILAAHRP----ACKIPDDLGFPEEMSVASLDLTGGLPEVATPES 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 12/43 (28%)
FOSNP_005243.1 Basic motif, required for the activation of phospholipid synthesis, but not for CDS1-binding 139..159 10/46 (22%)
bZIP_Fos 147..200 CDD:269869 15/53 (28%)
coiled coil 147..199 CDD:269869 15/52 (29%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 165..193 9/28 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R103
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.