DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16896 and TBC1D23

DIOPT Version :9

Sequence 1:NP_611973.2 Gene:CG16896 / 37977 FlyBaseID:FBgn0035073 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_608569.1 Gene:TBC1D23 / 33289 FlyBaseID:FBgn0031304 Length:689 Species:Drosophila melanogaster


Alignment Length:262 Identity:56/262 - (21%)
Similarity:99/262 - (37%) Gaps:51/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 PEKYRYLIWTSLLDLPCNGPQ---FQELIKLGAPLLVRNRAKKL--KIRNDHQRR--VVIKIWSC 558
            ||..|..:|...||:.....|   |.|:..|.....:|...::.  ::.||.:.:  ||..:.|.
  Fly    33 PEALRPDVWQVCLDVRHKSDQMSLFNEIYDLPFQSQLREDCQRHVDRMGNDEEDKVSVVSDLESI 97

  Fly   559 LAQWCKVLAHADFMP-----HLIFPFVKRMPKNSLVCFELIATLVLNHFQLCFE-FHP---LPPS 614
            :..:|| ..:..:.|     .|:.|         |...:|..:...|.|:...: :.|   .|..
  Fly    98 ITFYCK-NRNLQYEPDNGWIELLLP---------LFALKLNRSDTFNLFESIRDTYIPKGCRPKG 152

  Fly   615 NYLAMCENILQHCDEQLCKFYKSQEMLPKDFAWPLLSTAFSEVLEEEQWLSLWDNIFSEPPWFPV 679
            |...:...:|.:.|.:||....::::.|..::.....:.|:........:::||..|.....|.|
  Fly   153 NVFHVFRLLLLYHDPELCTLLDTKKITPDLYSLTWFQSLFASCSSLSVIIAMWDLYFQNADPFMV 217

  Fly   680 FLVVAYNLIN-REIILRLPDKRSVLFFFHDQNPVDISKLLSKARKLMSKCALALHPQRFMTHFSP 743
            |.:....||| ||.||::          ...:..:|.|.||     :..|||         .|..
  Fly   218 FFLALIILINGREQILQM----------RSSSKEEIIKFLS-----LMPCAL---------EFDD 258

  Fly   744 IP 745
            :|
  Fly   259 VP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16896NP_611973.2 WD40 228..>467 CDD:225201
BAR 766..>952 CDD:299863
SPFH_like <817..909 CDD:302763
TBC1D23NP_608569.1 RabGAP-TBC 34..233 CDD:278964 44/208 (21%)
RHOD 330..429 CDD:197731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.