DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16896 and AgaP_AGAP007749

DIOPT Version :9

Sequence 1:NP_611973.2 Gene:CG16896 / 37977 FlyBaseID:FBgn0035073 Length:988 Species:Drosophila melanogaster
Sequence 2:XP_317773.4 Gene:AgaP_AGAP007749 / 1278218 VectorBaseID:AGAP007749 Length:717 Species:Anopheles gambiae


Alignment Length:257 Identity:59/257 - (22%)
Similarity:98/257 - (38%) Gaps:49/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 PEKYRYLIWTSLLDL---PCNGPQFQELIKLGAPLLVRNRAKKL--KIRNDHQRR--VVIKIWSC 558
            ||..|..:|...|.:   |....||.|:..|....|:|:..::.  |:.|:.:.:  ||..:.|.
Mosquito    33 PEALRLDVWQVCLGVRNKPDQLAQFNEIYDLPFQALLRSDCEEFVSKLGNEDEDKVSVVCDLESI 97

  Fly   559 LAQWCK----VLAHADFMPHLIFPF--VKRMPKNSLVCFELIAT-----------LVLNHFQLCF 606
            |..:||    |....:....|:.|.  :|.:..::...||.|..           .|.|.|:|..
Mosquito    98 LTFYCKNRNLVYEPNNGWVELMLPLLSLKLIRSDTYNLFEAIRDTYIPKGCSKNGTVFNVFRLLL 162

  Fly   607 EFHPLPPSNYLAMCENILQHCDEQLCKFYKSQEMLPKDFAWPLLSTAFSEVLEEEQWLSLWDNIF 671
            .:|                  |.:||....::.:.|..:|.....|.|:........||:||..|
Mosquito   163 LYH------------------DPELCTILDTKRITPDCYAMGWFQTLFASTCTLPVVLSMWDLYF 209

  Fly   672 SEPPWFPVFLVVAYNLINR--EIILRLPDKRSVLFFFHDQNPVDISKLLSKARKLMSKCALA 731
            .:...|.||.:....|||:  :|:......:..|..|....|.:|     :|..::..|:||
Mosquito   210 QQSDPFLVFFLSLIVLINQRDQILAMKASTKEELIGFLVNMPCNI-----EADDVLDFCSLA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16896NP_611973.2 WD40 228..>467 CDD:225201
BAR 766..>952 CDD:299863
SPFH_like <817..909 CDD:302763
AgaP_AGAP007749XP_317773.4 RabGAP-TBC <130..233 CDD:278964 26/120 (22%)
RHOD 329..435 CDD:294087
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.