DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3611 and CG34169

DIOPT Version :8

Sequence 1:NP_001286858.1 Gene:CG3611 / 37972 FlyBaseID:FBgn0035069 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001097170.1 Gene:CG34169 / 5740400 FlyBaseID:FBgn0085198 Length:124 Species:Drosophila melanogaster

Alignment Length:124 Identity:39/125 (31%)
Similarity:65/125 (52%) Gaps:10/125 (8%)


  Fly     3 ADIVTTEQLRYQLAFSHAMERTTRHWQETFAWYPKMQCCHYQRIDQIYLTSRQRYGDGHFLKYAN 67
            ::::..:||::....:..:::|...|::..||:...|..:|.|...||..||:.|||..:..||.
  Fly     5 SEVIFVDQLKHFRVVASQIDKTRITWEKNSAWFADAQRENYSRYASIYAESRETYGDKMYGYYAR 69

  Fly    68 RRRLAKKFVV-----TAQEVAEGLEDLKMLEQDGITGLKVAVTENGEYGRMKPSKLYMC 121
            |.||..::.|     |.||:....|.:..|:.     .|.:.|.||||||::||.|:.|
  Fly    70 RNRLRSEYSVKSEAATRQEIRYENESMAHLKD-----YKYSETTNGEYGRVRPSALFFC 123



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131192797
eggNOG 1 0.900 E1_2C8YH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.