DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eps-15 and TPM1

Sequence 1:NP_611965.2 Gene:Eps-15 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:NP_014320.1 Gene:TPM1 SGDID:S000005023 Length:199 Species:Saccharomyces cerevisiae

Alignment Length:227 Identity:50/228 (22%)
Similarity:102/228 (45%) Gaps:41/228 (18%)


  Fly   414 EVKPTYSNPELEMIS--KEIEELARERRVLETEIAQKEADVR---IKNGEVRSLQSELDTLTATL 473
            :::...||.:||..|  ::.|||..:.:.||.|..:||..::   :||   :.|:.|::.|.|.|
Yeast     3 KIREKLSNLKLEAESWQEKYEELKEKNKDLEQENVEKENQIKSLTVKN---QQLEDEIEKLEAGL 64

  Fly   474 ---KQLENQRGEAQKRLDDLQAQVSHNTAVLANVSLDISRTNEQVTKIRDQCHMQEVTINEQEGE 535
               ||.|....|.:.::..|..: :|             :..|::.|:..:. .:...::|....
Yeast    65 SDSKQTEQDNVEKENQIKSLTVK-NH-------------QLEEEIEKLEAEL-AESKQLSEDSHH 114

  Fly   536 LNAKRSELQKLKDEEASLQKEYDSNNRELSKLTNHLQATQLQISSVRSMVTQLLETQRQMTDALL 600
            |.:......| |:::  |:::.:.::.:|.:.|..|:.:.|:...:...|. .||.||:      
Yeast   115 LQSNNDNFSK-KNQQ--LEEDLEESDTKLKETTEKLRESDLKADQLERRVA-ALEEQRE------ 169

  Fly   601 ICRAAMENQNAELVSEYQLKIEPDFDEARKTL 632
                ..|.:|.||..:|: ..:.:.||...:|
Yeast   170 ----EWERKNEELTVKYE-DAKKELDEIAASL 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009
EH 126..215 CDD:197477
EH 137..202 CDD:238009
EH 307..402 CDD:197477
EH 318..384 CDD:238009
RILP-like <445..548 CDD:304877 21/109 (19%)
Spc24 529..>584 CDD:285486 9/55 (16%)
TPM1NP_014320.1 Tropomyosin_1 7..186 CDD:315401 47/212 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.721928 Normalized mean entropy S4078
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.