DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eps-15 and TAX4

DIOPT Version :9

Sequence 1:NP_611965.2 Gene:Eps-15 / 37961 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:NP_012452.1 Gene:TAX4 / 853362 SGDID:S000003619 Length:604 Species:Saccharomyces cerevisiae


Alignment Length:155 Identity:41/155 - (26%)
Similarity:64/155 - (41%) Gaps:36/155 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 PVMANADWVVTPADLKRFEEIFRQSDLDKDGLVSGLEVKDIFIKSGIPQRSLADIWALCDTNQSG 365
            |.:||.|          .|...:..:|.:|||:..|.||||:.:|.:|:..|..|:.:.||.:.|
Yeast   466 PSLANED----------DESHLQPLNLPQDGLMLNLVVKDIWYRSNLPRDLLVQIYNMVDTRKDG 520

  Fly   366 KLTVEQFALAMWFVE-----RKQRGVDPPHVLNANMVPPSMRATVAGVDLQPQEVKPTYSN---- 421
            .|..:.|.:.||.|:     ||........|.|          :|.|..|....|||..|:    
Yeast   521 TLDRKSFIVGMWLVDQCLYGRKLTNELDQRVWN----------SVDGYVLGTINVKPATSDHYHN 575

  Fly   422 -------PELEMISKEIEELARERR 439
                   |....:.:|::.:.|:.|
Yeast   576 ANNPLDKPSKLSVRQELKNIKRDLR 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009
EH 126..215 CDD:197477
EH 137..202 CDD:238009
EH 307..402 CDD:197477 27/99 (27%)
EH 318..384 CDD:238009 24/70 (34%)
RILP-like <445..548 CDD:304877
Spc24 529..>584 CDD:285486
TAX4NP_012452.1 EH 463..557 CDD:197477 31/110 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0998
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.