DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eps-15 and AT1G21630

Sequence 1:NP_611965.2 Gene:Eps-15 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:NP_001185056.1 Gene:AT1G21630 AraportID:AT1G21630 Length:1247 Species:Arabidopsis thaliana

Alignment Length:1467 Identity:284/1468 (19%)
Similarity:496/1468 (34%) Gaps:521/1468 (35%)


  Fly    15 VYEAYYKLIDPKGTGAIEAMTAAKFLKKSGLSDVVLSRIWDLSDPSGKGFLDKPGFFVALKLVSL 79
            :::.|::..|..|.|.|....|..|.:.|.|...||:::|..:|....|:|.:..|:.|||||::
plant    12 LFDTYFRRADLDGDGHISGAEAVAFFQGSNLPKHVLAQVWSYADSKKAGYLGRAEFYNALKLVTV 76

  Fly    80 SQAGQVASMANIYLDIANP-------PKL-----------GELPKTMPSRIQTVPVASGGVANGD 126
            :|:.:..:...:...|.:|       ||:           |.||.|....:.::|..:.|| .|.
plant    77 AQSRRELTAEIVKAAIYSPASANIPAPKINLAATPSPQPRGVLPATQAQGVTSMPSVAAGV-RGP 140

  Fly   127 WSIGVIDR------------------LKYEQLFES----------LHPSNGMLPGNKVKGVL--- 160
            ...|.:..                  .:.:|.|:|          ..|:|..:|.:.:.|..   
plant   141 HMGGTVSTSNQQVVPGQQNQFTGIPPSQTQQNFQSPGMPAGGTNAPRPANQPMPSDWLSGRSVGP 205

  Fly   161 ---MDSKLPMSILGTIWDLADQDKDGNLDMHEFVVAMHLVYQTLQKRTIPSVLPPELRKPGGAGP 222
               ::|::|.|  .:.:.|...:...|     .:...|:.         |:|......:|..:.|
plant   206 SGNVNSQIPSS--QSTYGLTAPNSTAN-----HITKPHIT---------PAVTSSTTTRPQESAP 254

  Fly   223 PPKP---------AMPPPPAGAAMPRAP-----SGEG------FGDGGFVAN-----FPKDIAPP 262
            ...|         .:...|:...:|:.|     ||.|      |||...|.:     .|...|..
plant   255 VHNPQESSATFGSRVSNVPSNQLVPKDPKELAASGNGFTSDSLFGDVFSVTSTQPKQHPTGSAST 319

  Fly   263 AAIPPL---PVAVPPMTR-------IPPVGAVSSQPL-IQTD------------------PLIPI 298
            ..|..:   .||.|.:|:       ||..|::|...: :||.                  |...:
plant   320 TGISSVTTGTVAGPEITQSVVRQSSIPQQGSLSQHAVGVQTQLTGNSGQPYTSSGAASGPPGSTV 384

  Fly   299 GAPVMANAD-----------------------W-VVTPADLKRFEEIFRQSDLDKDGLVSGLEVK 339
            |..:.|.:.                       | .:||||::::.::|.|.|.|:||.::|.:.:
plant   385 GVGISATSQLAQRPPHPHSQPQPRPQGQSQPPWPKMTPADVQKYTKVFVQVDTDRDGKITGNQAR 449

  Fly   340 DIFIKSGIPQRSLADIWALCDTNQSGKLTVEQFALAMWFVERKQRGVDPPHVLNANMVPPSMRAT 404
            ::|:...:|:.:|..:|.|.|.:....|::.:|.:|::.:||.:.|...|.|..::::......|
plant   450 NLFLSWRLPRDALKQVWDLSDQDNDSMLSLREFCIAVYLMERYREGRPLPPVFPSSIIHSESMFT 514

  Fly   405 VAG---------------------------------------VDLQPQE--VKPTYSNPELEMIS 428
            ..|                                       |.|.|.:  |:||....::.::.
plant   515 SPGQSVAPHGNASWGHPQGFQQQPHPGGLRPPAGPKGKPPRPVPLSPSDGMVQPTQPKRKMPVLE 579

  Fly   429 KE-IEELARERR-VLETEIAQKEA---------------------DVRIK------------NGE 458
            |. :::|::|.: .|.|:..:..|                     .:.:|            ..|
plant   580 KPLVDQLSKEEQDSLNTKFEEATAVDKKFSFFAFSIRRYLLPLPYGIYMKYLWICVAIVDELEKE 644

  Fly   459 VRSLQSELDTLTATLKQLENQRGEAQKRLDDLQAQVSHNTAVLANVSLDISRTNEQVTKIRDQCH 523
            :...:.::|...|.:::|...:.....|.:::..:|..:...|.:::.......::...:..:..
plant   645 IADSKQKIDFFRAKMQELVLYKSRCDNRYNEIAERVLGDKRELESLAKKYEEKYKKSGNVGSKLT 709

  Fly   524 MQEVTINEQEGELNAKRSELQK--LKDEEASLQKEYDSNNRELSKLTNHLQATQLQISSVRSMVT 586
            ::|.|..    ::..|:.||.:  :|.||..|.   ||    :.|.|.|:|      |.:..::.
plant   710 IEEATFR----DIQEKKMELYQAIVKFEEGKLD---DS----IVKRTEHIQ------SGLEELIK 757

  Fly   587 QLLETQRQMTDALLICRAAMENQNAELV----------SEYQLKIEPDFDEAR-------KTLTK 634
            .|.|..:|.         .:..:...||          .|.....:.|:|:..       |.||.
plant   758 NLNERCKQY---------GVRGKPTSLVELPFGWQPGIQEGAADWDEDWDKLEDEGFTFVKELTL 813

  Fly   635 EVQLPKDDPFEENN--------SGAANQATNGFGSDPFSGQPVNKPAISTGFDDSFNMSSGFDSG 691
            ::|.....|.|:::        |....:..:...:|..:|:..     |:|.:|| ..|.|..|.
plant   814 DIQNVIAPPKEKSSAWRKEVDVSSKEGEDVSFSDADSKTGKKQ-----SSGEEDS-EQSEGKTSD 872

  Fly   692 FDAFGQSGAGSAFGQTQRDPFGSDAFAANKSNAITPEPGKDDFGSDPFAA------LHAPTGQGQ 750
            .||..::  ||......|.  |.:|.::.::.....|.|.||..|...|.      .|..|....
plant   873 VDARDKN--GSLDDSKVRK--GIEADSSPRTKDTRSENGHDDGESTASAGKTVNYDSHDETDSVS 933

  Fly   751 VLSPNAQKSGPPPRPESPSPALPPKKSKVPPPRPAPPRAAQPTGGFGSGGGGGFADFDDFDNK-- 813
            .::|:..|.                               :..|.:.||.|.||. ||||..|  
plant   934 SVNPDNGKD-------------------------------KDHGKYDSGFGFGFG-FDDFSIKPI 966

  Fly   814 -------LHHIP--------SAPSPSATA--LSPLPPTLPA----PIPVVSGSSLLDSFTLFDDP 857
                   ...:|        |.|||.|.|  :||..|:|.|    ..|..:.:|.....:.||| 
plant   967 KTGSTISNDFLPPKLSIFADSVPSPPANASDVSPTKPSLFADSVPSTPATNNASYPGQKSFFDD- 1030

  Fly   858 GQIHKQAASTPNPTPITVPTVHTLLQTSLSTPAAPSPALASLSTSGSGSVAGAGADLPSSVTITT 922
                            :||          ||||.|....|...:....||               
plant  1031 ----------------SVP----------STPAYPGNLFAEKKSFFDDSV--------------- 1054

  Fly   923 APSLNNQHLSRSNTPLQNQRTADVKLETKAVVSVFDAFGEIGTRKAP-TPSLITGPTDFKDDPF- 985
             ||          ||..   ..::..|.|   |.||       ...| ||:..|  :||...|| 
plant  1055 -PS----------TPAY---PGNLFAEKK---SYFD-------DSVPSTPAYST--SDFGGKPFA 1093

  Fly   986 -KDYRYEDPFSIKDPFAEEGEEELSEGKGADHKRNFAEDFSSGDEIGSAAKTLSNIVNNNSIKPK 1049
             :..|.::.|..:.||                         ..|.:.|.              |.
plant  1094 SETPRSDNLFPGRSPF-------------------------MFDSVPST--------------PA 1119

  Fly  1050 AATPLNNDLLQQFDAFNLNSSPAPSHHSGTSYHSNSKPSHDSQTALDAFAD-FDDFAATLATTGG 1113
            |....:|:...:||:||.|::.|.|.....|..|.|:|        |.||. ||.|         
plant  1120 AHDDFSNNSFSRFDSFNSNNNDAFSLSRTDSMRSTSEP--------DPFASRFDSF--------- 1167

  Fly  1114 SGAATTATTTGNTKLNNSFFDAFNDNFSVIQSSSVPTGVVRPNDQRAKAFDAFNDNFEDQFKTSP 1178
                           |...:|:||                      |:::|:.::|...:   :|
plant  1168 ---------------NYQRYDSFN----------------------AQSYDSSSNNNASE---TP 1192

  Fly  1179 NANFAKFDGFEA---HNFSSDFG---NASFGTTGKEK 1209
            .|:..:||...:   .::|..||   :..||:||..|
plant  1193 KASLTRFDSIGSTRDSDYSHGFGFDDHDPFGSTGPFK 1229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009 22/66 (33%)
EH 126..215 CDD:197477 16/123 (13%)
EH 137..202 CDD:238009 13/81 (16%)
EH 307..402 CDD:197477 26/119 (22%)
EH 318..384 CDD:238009 18/66 (27%)
RILP-like <445..548 CDD:304877 15/138 (11%)
Spc24 529..>584 CDD:285486 14/57 (25%)
AT1G21630NP_001185056.1 EH 13..79 CDD:238009 22/66 (33%)
EF-hand_7 17..71 CDD:290234 16/54 (30%)
TFIIA 95..>263 CDD:281188 30/185 (16%)
EH 416..509 CDD:197477 26/93 (28%)
EH 428..494 CDD:238009 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1594
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11216
Phylome 00.000 Not matched by this tool.
44.150

Return to query results.
Submit another query.